UCHL3 Protein, Rat (His)
Based on 1 Customer Validation
The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.
Background
UCHL3 Protein, a deubiquitinating enzyme (DUB), intricately governs cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. Functioning as a thiol protease, UCHL3 selectively recognizes and hydrolyzes peptide bonds at the C-terminal glycine of ubiquitin or NEDD8, displaying a notable 10-fold preference for Arg and Lys at position P3 and a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, thereby finely regulating apical membrane recycling. Its influence extends to insulin signaling and adipogenesis, indirectly enhancing the phosphorylation of IGFIR, AKT, and FOXO1. Essential for stress-response in retinal, skeletal muscle, and germ cell maintenance, UCHL3 may also play a role in working memory. Notably, it exhibits the capability to hydrolyze UBB(+1), a mutated form of ubiquitin resistant to proteasomal degradation, emphasizing its significance in the dynamic control of cellular processes and homeostasis.
Verified Bioactivity
The specific activity of UCHL3 was 68.654 nmoL/min/mg in DUB assay using ubiquitin-based proluciferin as substrate.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-His
-
Accession
Q91Y78 (E2-A230)
-
Molecular Construction
-
N-term
-
His
-
UCHL3 (E2-A230)
Accession # Q91Y78 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UCHL3; Ubiquitin C-Terminal Hydrolase L3; Ubiquitin Carboxyl-Terminal Esterase L3 (Ubiquitin Thiolesterase); Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3; Ubiquitin Thioesterase L3; Ubiquitin Thiolesterase; UCH-L3; Ubiquitin Carboxyl-Terminal Hydrolas
-
AA Sequence
EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
-
Predicted Molecular Mass
26 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)