UCHL3 Protein, Rat (His)

Customer Review

Based on 1 Customer Validation

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Background

UCHL3 Protein, a deubiquitinating enzyme (DUB), intricately governs cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. Functioning as a thiol protease, UCHL3 selectively recognizes and hydrolyzes peptide bonds at the C-terminal glycine of ubiquitin or NEDD8, displaying a notable 10-fold preference for Arg and Lys at position P3 and a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, thereby finely regulating apical membrane recycling. Its influence extends to insulin signaling and adipogenesis, indirectly enhancing the phosphorylation of IGFIR, AKT, and FOXO1. Essential for stress-response in retinal, skeletal muscle, and germ cell maintenance, UCHL3 may also play a role in working memory. Notably, it exhibits the capability to hydrolyze UBB(+1), a mutated form of ubiquitin resistant to proteasomal degradation, emphasizing its significance in the dynamic control of cellular processes and homeostasis.

Verified Bioactivity

The specific activity of UCHL3 was 68.654 nmoL/min/mg in DUB assay using ubiquitin-based proluciferin as substrate.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • UCHL3 (E2-A230)
      Accession # Q91Y78
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UCHL3; Ubiquitin C-Terminal Hydrolase L3; Ubiquitin Carboxyl-Terminal Esterase L3 (Ubiquitin Thiolesterase); Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3; Ubiquitin Thioesterase L3; Ubiquitin Thiolesterase; UCH-L3; Ubiquitin Carboxyl-Terminal Hydrolas

  • AA Sequence

    EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

  • Predicted Molecular Mass

    26 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00