VEGFR-1 Protein, Human (328a.a, HEK293, His)
Based on 1 Customer Validation
The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, His) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, His) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
VEGFR-1 Protein is a tyrosine-protein kinase that serves as a cell-surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in various biological processes, including embryonic vasculature development, angiogenesis regulation, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Additionally, VEGFR-1 acts as a positive regulator of postnatal retinal hyaloid vessel regression and may function as a negative regulator of embryonic angiogenesis by inhibiting excessive endothelial cell proliferation. In adulthood, it promotes endothelial cell proliferation, survival, and angiogenesis, although its proliferative effects appear to be cell-type specific. VEGFR-1 has a high affinity for VEGFA and acts as a negative regulator of its signaling by limiting the availability of free VEGFA and preventing its binding to KDR. It modulates KDR signaling by forming heterodimers with KDR. Ligand binding to VEGFR-1 activates several signaling cascades, including PLCG, MAPK1/ERK2, MAPK3/ERK1, AKT1, and PI3K pathways. VEGFR-1 also phosphorylates SRC, YES1, CBL, AKT1, PTK2/FAK1, and PLCG.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit the VEGF-dependent proliferation of human umbilical vein endothelial cells ( HUVEC ). The ED50 for this effect is typically 10-40 ng/mL in the presence of 10 ng/mL human VEGF165.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P17948-4/NP_001153503.1 (S27-I328)
-
Molecular Construction
-
N-term
-
VEGFR-1 (S27-I328)
Accession # P17948-4/NP_001153503.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FLT1; Tyrosine-Protein Kinase FRT; Prev. FLT; FLT-1; Vascular Endothelial Growth Factor Receptor 1; Vascular Endothelial Growth Factor Receptor 1 Variant; VEGFR1; Platelet-Derived Growth Factor Receptor-Like Protein; Vascular Permeability Factor Receptor;
-
AA Sequence
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
-
Predicted Molecular Mass
35.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
