1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. VEGF & VEGFR Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. VEGFR
  5. VEGFR-1
  6. VEGFR-1 Protein, Human (328a.a, HEK293, His)

VEGFR-1 Protein, Human (328a.a, HEK293, His)

Cat. No.: HY-P73065
Handling Instructions

The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, His) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of VEGFR-1 Protein, Human (328a.a, HEK293, His) is 328 a.a., with molecular weight of ~35.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, His) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of VEGFR-1 Protein, Human (328a.a, HEK293, His) is 328 a.a., with molecular weight of ~35.6 kDa.

Background

VEGFR-1 Protein is a tyrosine-protein kinase that serves as a cell-surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in various biological processes, including embryonic vasculature development, angiogenesis regulation, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Additionally, VEGFR-1 acts as a positive regulator of postnatal retinal hyaloid vessel regression and may function as a negative regulator of embryonic angiogenesis by inhibiting excessive endothelial cell proliferation. In adulthood, it promotes endothelial cell proliferation, survival, and angiogenesis, although its proliferative effects appear to be cell-type specific. VEGFR-1 has a high affinity for VEGFA and acts as a negative regulator of its signaling by limiting the availability of free VEGFA and preventing its binding to KDR. It modulates KDR signaling by forming heterodimers with KDR. Ligand binding to VEGFR-1 activates several signaling cascades, including PLCG, MAPK1/ERK2, MAPK3/ERK1, AKT1, and PI3K pathways. VEGFR-1 also phosphorylates SRC, YES1, CBL, AKT1, PTK2/FAK1, and PLCG.

Species

Human

Source

HEK293

Tag

C-His

Accession

P17948 (M1-I328)

Gene ID
Molecular Construction
N-term
VEGFR-1 (M1-I328)
Accession # P17948
His
C-term
Synonyms
Vascular endothelial growth factor receptor 1; FLT; FLT1; FRT; VEGFR-1
AA Sequence

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI

Molecular Weight

Approximately 35.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGFR-1 Protein, Human (328a.a, HEK293, His)
Cat. No.:
HY-P73065
Quantity:
MCE Japan Authorized Agent: