1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. VEGF & VEGFR Receptor Tyrosine Kinases Cytokine Receptors Protein Tyrosine Kinases
  4. VEGFR
  5. FLK-1/VEGFR-2
  6. VEGFR-2 Protein, Human (327a.a, HEK293, Fc)

VEGFR-2 protein is a tyrosine protein kinase receptor for VEGFA, VEGFC and VEGFD and is critical in angiogenesis, blood vessel development and embryonic hematopoiesis. It promotes endothelial cell function and actin cytoskeletal reorganization. VEGFR-2 Protein, Human (327a.a, HEK293, Fc) is the recombinant human-derived VEGFR-2 protein, expressed by HEK293 , with C-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

VEGFR-2 protein is a tyrosine protein kinase receptor for VEGFA, VEGFC and VEGFD and is critical in angiogenesis, blood vessel development and embryonic hematopoiesis. It promotes endothelial cell function and actin cytoskeletal reorganization. VEGFR-2 Protein, Human (327a.a, HEK293, Fc) is the recombinant human-derived VEGFR-2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

VEGFR-2 protein, a tyrosine-protein kinase, serves as a cell-surface receptor for VEGFA, VEGFC, and VEGFD, playing a pivotal role in the intricate regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. It actively promotes the proliferation, survival, migration, and differentiation of endothelial cells, while also influencing the reorganization of the actin cytoskeleton. Certain isoforms, lacking a transmembrane domain like isoform 2 and isoform 3, may function as decoy receptors, modulating VEGFA, VEGFC, and/or VEGFD signaling. Specifically, isoform 2 acts as a negative regulator of VEGFA- and VEGFC-mediated lymphangiogenesis by limiting the availability of free VEGFA and/or VEGFC, preventing their binding to FLT4. VEGFR-2 modulates FLT1 and FLT4 signaling through heterodimer formation. Binding of vascular growth factors to isoform 1 triggers multiple signaling cascades, including the activation of PLCG1, resulting in the production of diacylglycerol and inositol 1,4,5-trisphosphate and the subsequent activation of protein kinase C. Additionally, VEGFR-2 mediates the activation of MAP kinase signaling pathways, AKT1 signaling pathway, and the phosphorylation of PIK3R1, contributing to the reorganization of the actin cytoskeleton and the activation of PTK2/FAK1. Its crucial role extends to facilitating VEGFA-mediated induction of NOS2 and NOS3, leading to the production of the signaling molecule nitric oxide (NO) by endothelial cells. VEGFR-2's phosphorylation activity includes PLCG1, FYN, NCK1, NOS3, PIK3R1, PTK2/FAK1, and SRC, highlighting its comprehensive involvement in modulating diverse cellular processes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P35968-1/NP_002244.1 (A20-K327)

Gene ID
Molecular Construction
N-term
VEGFR-2 (A20-K327)
Accession # P35968-1/NP_002244.1
hFc
C-term
Protein Length

Partial

Synonyms
Vascular endothelial growth factor receptor 2; KDR; VEGFR-2; FLK-1; CD309
AA Sequence

ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK

Predicted Molecular Mass
61.5 kDa
Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

VEGFR-2 Protein, Human (327a.a, HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
VEGFR-2 Protein, Human (327a.a, HEK293, Fc)
Cat. No.:
HY-P73476
Cantidad:
MCE Japan Authorized Agent: