2. Anti-infection
  3. Influenza Virus
  4. TAT-HA2 Fusion Peptide

TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

TAT-HA2 Fusion Peptide

TAT-HA2 Fusion Peptide Chemische Struktur

CAS. Nr. : 923954-79-4

Größe Preis Verfügbarkeit Menge
5 mg Auf Lager
10 mg Auf Lager
25 mg Auf Lager
50 mg Auf Lager
100 mg Auf Lager
200 mg   Angebot einholen  
500 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 1 Customer Validation

Other Forms of TAT-HA2 Fusion Peptide:

TAT-HA2 Fusion Peptide Related Antibodies

Top Publications Citing Use of Products

  • Biologische Aktivität

  • Reinheit & Dokumentation

  • Verweise

  • Kundenbewertung

Beschreibung

TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules[1].

In Vitro

TAT HA2 peptide (transactivator of transcription and hemaglutanin) can be used for endosomal release. TAT HA2 results in positively charged gold nanorods (GNRs)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

TAT-HA2 Fusion Peptide Related Antibodies
Molekulargewicht

3432.92

Formel

C149H243N53O39S
CAS. Nr.
Appearance

Solid

Color

White to off-white

Sequence

Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly
Sequence Shortening

RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Lösungsmittel & Löslichkeit
In Vitro: 

H2O : 100 mg/mL (29.13 mM; ultrasonic and warming and heat to 60°C)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2913 mL 1.4565 mL 2.9130 mL
5 mM 0.0583 mL 0.2913 mL 0.5826 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molaritätsrechner

  • Verdünnungsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Reinheit & Dokumentation
Verweise

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2913 mL 1.4565 mL 2.9130 mL 7.2824 mL
5 mM 0.0583 mL 0.2913 mL 0.5826 mL 1.4565 mL
10 mM 0.0291 mL 0.1456 mL 0.2913 mL 0.7282 mL
15 mM 0.0194 mL 0.0971 mL 0.1942 mL 0.4855 mL
20 mM 0.0146 mL 0.0728 mL 0.1456 mL 0.3641 mL
25 mM 0.0117 mL 0.0583 mL 0.1165 mL 0.2913 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

TAT-HA2 Fusion Peptide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

TAT-HA2 Fusion Peptide923954-79-4Influenza ViruspH-sensitiveHA2InfluenzaTATHIVInhibitorinhibitorinhibit

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Produktname

  

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

      

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
TAT-HA2 Fusion Peptide
Art. -Nr.:
HY-P4108
Menge:
MCE Japan Authorized Agent:

Kundenbewertung

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Produktname

  

Lot #

Name des Antragstellers *

 

E-Mail-Addresse *

Telefonnummer

 

Department *

Name der Organisation *

 

Country or Region *

Bemerkungen

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.