TAT-HA2 Fusion Peptide

Name: TAT-HA2 Fusion Peptide
Brand: MedChemExpress
SKU: HY-P4108
Rating: 4.5 (0 reviews)

Cat. No.: HY-P4108 Purity: 99.70%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

TAT-HA2 Fusion Peptide 화학구조

CAS No. : 923954-79-4

사이즈	재고	수량
5 mg	해외재고보유	Estimated Time of Arrival: December 31
10 mg	해외재고보유	Estimated Time of Arrival: December 31
25 mg	해외재고보유	Estimated Time of Arrival: December 31
50 mg	해외재고보유	Estimated Time of Arrival: December 31
100 mg	해외재고보유	Estimated Time of Arrival: December 31
200 mg	견적 받기
500 mg	견적 받기

or 대량구매 문의

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

고객리뷰

Based on 1 Customer Validation

Other Forms of TAT-HA2 Fusion Peptide:

Cys-TAT-HA2 견적 받기

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
순도&문서
References
고객리뷰

제품 설명

In Vitro

TAT HA2 peptide (transactivator of transcription and hemaglutanin) can be used for endosomal release. TAT HA2 results in positively charged gold nanorods (GNRs)^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

분자량

3432.92

화학식

C₁₄₉H₂₄₃N₅₃O₃₉S

CAS No.

923954-79-4

Appearance

Solid

Color

White to off-white

Sequence

Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly

Sequence Shortening

RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG

선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

용액&용해도

In Vitro:

H₂O : 100 mg/mL (29.13 mM; ultrasonic and warming and heat to 60°C)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2913 mL	1.4565 mL	2.9130 mL
5 mM	0.0583 mL	0.2913 mL	0.5826 mL
10 mM	0.0291 mL	0.1456 mL	0.2913 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

몰농도 계산기
농도 희석 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

순도&문서

Purity: 99.70%

Select Batch:

Data Sheet (279 KB) SDS (252 KB)

COA (258 KB) RP-HPLC (265 KB) MS (71 KB) Elemental Analysis Report (116 KB)

Handling Instructions (2659 KB)

References

[1]. Emily A Untener, et al. Tannic acid coated gold nanorods demonstrate a distinctive form of endosomal uptake and unique distribution within cells. ACS Appl Mater Interfaces. 2013 Sep 11;5(17):8366-73. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2913 mL	1.4565 mL	2.9130 mL	7.2824 mL
	5 mM	0.0583 mL	0.2913 mL	0.5826 mL	1.4565 mL
	10 mM	0.0291 mL	0.1456 mL	0.2913 mL	0.7282 mL
	15 mM	0.0194 mL	0.0971 mL	0.1942 mL	0.4855 mL
	20 mM	0.0146 mL	0.0728 mL	0.1456 mL	0.3641 mL
	25 mM	0.0117 mL	0.0583 mL	0.1165 mL	0.2913 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.