2. GPCR/G Protein
  3. CRFR
  4. [Tyr0] Corticotropin Releasing Factor, ovine

[Tyr0] Corticotropin Releasing Factor, ovine is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin.

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

[Tyr0] Corticotropin Releasing Factor, ovine

[Tyr0] Corticotropin Releasing Factor, ovine Estructura química

No. CAS : 83930-34-1

Tamaño Stock
50 mg   Obtener un presupuesto  
100 mg   Obtener un presupuesto  
250 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

[Tyr0] Corticotropin Releasing Factor, ovine Related Antibodies

Top Publications Citing Use of Products

Ver todos los productos específicos de isoformas CRFR:

Ver todas las isoformas
CRFR1 CRFR2

  • Actividad biológica

  • Pureza y Documentación

  • Referencias

  • Revisión del cliente

Descripciòn

[Tyr0] Corticotropin Releasing Factor, ovine is a corticotropin releasing factor/hormone isolated from ovine. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin[1][2].

In Vitro

[Tyr0] Corticotropin Releasing Factor, ovine has a strong binding effect with plasma protein[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

[Tyr0] Corticotropin Releasing Factor, ovine Related Antibodies
In Vivo

[Tyr0] Corticotropin Releasing Factor, ovine (328 μCi/μg; 198 pg/min or 225 pg/min; continuous infusions intravenous; single dose lasting 5-7 hr) shows a long plasma half-life and low metabolic clearance rate in male cynomolgus monkeys[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Young adult male cynomolgus monkeys (4.0-6.9 kg)[1]
Dosage: 10 mL/h for 198 pg/min or 225 pg/min
Administration: Continuous infusions intravenous; collected every 60 min during 5-7 hr
Result: Showed a longer plasma half-life than for all other known hypothalamic peptides and its metabolic clearance rate was relatively low and considerably less all other known hypothalamic peptides or adreno-cortico-tropic-hormone (ACTH).
Peso molecular

4833.48

Fòrmula

C214H348N60O65S
No. CAS
Sequence

Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence Shortening

YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

[Tyr0] Corticotropin Releasing Factor, ovine Related Classifications

  • Calculadora de molaridad

  • Calculadora de dilución

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

[Tyr0] Corticotropin Releasing Factor, ovine83930-34-1CRFRCorticotropin-releasing Factor ReceptorCRHRhypothalamic hormoneadrenocorticotrophic hormoneACTHCRFCRHInhibitorinhibitorinhibit

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Nombre del producto

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
[Tyr0] Corticotropin Releasing Factor, ovine
Cat. No.:
HY-P3687
Cantidad:
MCE Japan Authorized Agent:

Revisión del cliente

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Direcciòn del E-mail *

Número de teléfono

 

Department *

Nombre de la Organizaciòn *

 

Country or Region *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.