2. GPCR/G Protein Neuronal Signaling
  3. Melanocortin Receptor
  4. Adrenocorticotropic Hormone (ACTH) (1-39), human

Adrenocorticotropic Hormone (ACTH) (1-39), human  (Synonyms: 1-39-Corticotropin (human))

Art. -Nr.: HY-P1211 Reinheit: 99.94%
COA
SDS
Handling Instructions Technical Support

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

Adrenocorticotropic Hormone (ACTH) (1-39), human

Adrenocorticotropic Hormone (ACTH) (1-39), human Chemische Struktur

CAS. Nr. : 12279-41-3

Größe Preis Verfügbarkeit Menge
5 mg Auf Lager
10 mg Auf Lager
25 mg Auf Lager
50 mg   Angebot einholen  
100 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 1 Customer Validation

Other Forms of Adrenocorticotropic Hormone (ACTH) (1-39), human:

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Antibodies

Top Publications Citing Use of Products

Alle Melanocortin Receptor Isoform-spezifische Produkte anzeigen:

Alle Isoformen anzeigen
MC1R MC3R MC2R MC4R MC5R

  • Biologische Aktivität

  • Protokoll

  • Reinheit & Dokumentation

  • Verweise

  • Kundenbewertung

Beschreibung

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

IC50 & Target

Melanocortin receptor[1]
In Vitro

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH 1-39), a member of the melanocortin family, stimulates production of CS by the adrenals, but melanocortin receptors are also found in the central nervous system (CNS) and on immune cells. ACTH 1-39 protects neurons in vitro from several apoptotic, excitotoxic and inflammation-related insults[1].
The conditioned medium (CM) is prepared from untreated astroglia (AS) cultures and from AS cultures treated with 200 nM ACTH 1-39 for 24 h, washed to remove ACTH 1-39, then incubated for another 24 h in DMEM. In initial experiments, no difference is found in oligodendroglia (OL) viability in the presence of OL definedmediumwith 2% newborn calf serum (NCS) or AS CM (prepared in DMEM with no serum). After 24 h, OL death under each condition varies between 1 and 4%. Similar results for OL viability are obtained with microglia (MG) CM. In subsequent experiments, controls in each experiment consist of OL in defined medium with 2% NCS[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Antibodies
Molekulargewicht

4541.14

Formel

C207H308N56O58S
CAS. Nr.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Sequence Shortening

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Lösungsmittel & Löslichkeit
In Vitro: 

H2O : ≥ 100 mg/mL (22.02 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2202 mL 1.1010 mL 2.2021 mL
5 mM 0.0440 mL 0.2202 mL 0.4404 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molaritätsrechner

  • Verdünnungsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Reinheit & Dokumentation

Purity: 99.94%

SDS (557 KB)

COA (240 KB) RP-HPLC (256 KB) MS (143 KB)

Handling Instructions (2659 KB)
Verweise
Zellassay
[2]

For analysis of the effects of ACTH 1-39 or CM on oligodendroglia (OL) death, purified OL cultures are incubated with ACTH 1-39 at 200 nM or the various CM for 30 min before addition of the toxic agents. Cell death is assessed after 1 day using trypan blue uptake as the indicator of cell death. Trypan blue is considered a preferred method for measurement of total cell death compared to terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL), which measures only apoptosis, or live/dead fluorescent assays, which may not detect permeable dead cells with degraded DNA, thus underestimating cell death. Differentiated OL are identified by their characteristicmorphology, that is, rounded or oval birefringent cells with multiple lacy branching processes, and in some cases by immunostaining with antibodies to galactolipids[2].

MCE hat die Genauigkeit dieser Methoden nicht unabhängig bestätigt. Sie dienen nur als Referenz.
Verweise

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2202 mL 1.1010 mL 2.2021 mL 5.5052 mL
5 mM 0.0440 mL 0.2202 mL 0.4404 mL 1.1010 mL
10 mM 0.0220 mL 0.1101 mL 0.2202 mL 0.5505 mL
15 mM 0.0147 mL 0.0734 mL 0.1468 mL 0.3670 mL
20 mM 0.0110 mL 0.0551 mL 0.1101 mL 0.2753 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Adrenocorticotropic Hormone (ACTH) (1-39), human12279-41-31-39-Corticotropin (human)Melanocortin ReceptorMC ReceptorInhibitorinhibitorinhibit

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Produktname

  

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

      

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Adrenocorticotropic Hormone (ACTH) (1-39), human
Art. -Nr.:
HY-P1211
Menge:
MCE Japan Authorized Agent:

Kundenbewertung

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Produktname

  

Lot #

Name des Antragstellers *

 

E-Mail-Addresse *

Telefonnummer

 

Department *

Name der Organisation *

 

Country or Region *

Bemerkungen

SAFETY DATA SHEET (SDS)

English - EN (557 KB) Français - FR (557 KB) Deutsch - DE (557 KB) Norwegian - NO (557 KB) Español - ES (557 KB) Swedish - SV (557 KB) Italian - IT (557 KB) Korean - KR (557 KB) Portuguese - PT (557 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.