CRF, bovine
Based on 2 publication(s) in Google Scholar
CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.
For research use only. We do not sell to patients.
- CAS No.: 92307-52-3
- Formula: C206H340N60O63S
- Molecular Weight:4697.34
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocol
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) CRF, bovine
More
Biological Activity
Ki: 3.52 nM (CRF receptor)[1]
CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM[1]. CRF shows pEC50s of 11.16, 8.53 and 8.70 for human CRF1, human CRF2 and rat CRF2α[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 92307-52-3
-
Molecular Weight 4697.34
-
Formula C206H340N60O63S
-
Synonyms
Corticotropin Releasing Factor bovine
-
Sequence
Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
-
Sequence Shortening
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Sci Adv
Hyperexcitation of ovBNST CRF neurons during stress contributes to female-biased expression of anxiety-like avoidance behaviors. [Abstract]2024 May 10;10(19):eadk7636. PMID: 38728397 -
Pain
Mast cell corticotropin-releasing factor receptor 1 contributes to pancreatic cancer pain via mitogen-activated protein kinase/sphingosine kinases type 1 signaling. [Abstract]2026 Apr 1;167(4):962-975. PMID: 41615309
Protocol
CRF (1 μM) is added to the cell cultures that are further incubated for 5, 15 and 30 min at 37°C. Control cells are incubated with medium only. Following incubation time, cells are lysed directly on the growth dish using the detergent provided by the cAMP enzyme immunoassay kit. Following trypan blue staining to ensure complete lysis, the cell lysate is collected and assayed for cAMP. In some cases, the brain microvessel endothelial cells (BMEC) are treated with forskolin or pretreated either with the CRFR antagonist Antalarmin (1 μM) or the ATP analogue 2′5′-deoxyadenosine for 5 min at 37°C[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
References
[1]. Hogg JE, et al. The human neuroblastoma cell line, IMR-32, expresses functional corticotropin-releasing factor receptors. Eur J Pharmacol. 1996 Sep 26;312(2):257-61. [Content Brief]
[2]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [Content Brief]
[3]. Esposito P, et al. Corticotropin-releasing factor (CRF) can directly affect brain microvessel endothelial cells. Brain Res. 2003 Apr 11;968(2):192-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
CRF, bovine Related Classifications
HY-P1533 Related Classifications
Powered by Bioz