1. GPCR/G Protein
  2. CRFR

CRF,bovine (Synonyms: Corticotropin Releasing Factor bovine)

Cat. No.: HY-P1533
Handling Instructions

CRF,bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM. Sequence: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CRF,bovine Chemical Structure

CRF,bovine Chemical Structure

CAS No. : 92307-52-3

Size Price Stock
500 μg USD 180 Get quote
1 mg USD 290 Get quote
5 mg USD 990 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


CRF,bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM. Sequence: Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2.

IC50 & Target

Ki: 3.52 nM (CRF receptor)[1]

In Vitro

CRF,bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM[1]. CRF shows pEC50s of 11.16, 8.53 and 8.70 for human CRF1, human CRF2 and rat CRF[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC[3].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2129 mL 1.0644 mL 2.1289 mL
5 mM 0.0426 mL 0.2129 mL 0.4258 mL
10 mM 0.0213 mL 0.1064 mL 0.2129 mL
*Please refer to the solubility information to select the appropriate solvent.
Cell Assay

CRF (1 μM) is added to the cell cultures that are further incubated for 5, 15 and 30 min at 37°C. Control cells are incubated with medium only. Following incubation time, cells are lysed directly on the growth dish using the detergent provided by the cAMP enzyme immunoassay kit. Following trypan blue staining to ensure complete lysis, the cell lysate is collected and assayed for cAMP. In some cases, the brain microvessel endothelial cells (BMEC) are treated with forskolin or pretreated either with the CRFR antagonist Antalarmin (1 μM) or the ATP analogue 2′5′-deoxyadenosine for 5 min at 37°C[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight







Please store the product under the recommended conditions in the Certificate of Analysis.


Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Cat. No.:


Cat. No.: HY-P1533