Galanin (1-30), human
Based on 1 publication(s) in Google Scholar
Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM.
For research use only. We do not sell to patients.
- Purity : 99.65%
- CAS No.: 119418-04-1
- Formula: C139H210N42O43
- Molecular Weight:3157.46
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Galanin (1-30), human
MoreAll Neuropeptide Y Receptor Isoforms
More
Biological Activity
Description
IC50 & Target
Kd: 1 nM (GalR1 receptor), 1 nM (GalR2 receptor)[2]
In Vitro
Galanin (1-30), human (Gal1-30) is an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM[1]. Galanin (1-30), human displaces 125I-labeled rat galanin with a Kd of 0.5 nM. Galanin (1-30), human (hGal) causes contractions of isolated longitudinal rat fundus strips, with an ED50 of 13.8 ± 1.6 nM[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 119418-04-1
-
Appearance Solid
-
Molecular Weight 3157.46
-
Formula C139H210N42O43
-
Color White to off-white
-
Synonyms
Glanin
-
Sequence
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
-
Sequence Shortening
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
bioRxiv
2024 Jul 26:2024.07.26.605282. PMID: 39091869
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (31.67 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 1 mg/mL (0.32 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Hua XY, et al. Galanin acts at GalR1 receptors in spinal antinociception: synergy with morphine and AP-5. J Pharmacol Exp Ther. 2004 Feb;308(2):574-82. [Content Brief]
[2]. Schmidt WE, et al. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11435-9. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.3167 mL | 1.5836 mL | 3.1671 mL | 7.9178 mL |
| 5 mM | 0.0633 mL | 0.3167 mL | 0.6334 mL | 1.5836 mL | |
| 10 mM | 0.0317 mL | 0.1584 mL | 0.3167 mL | 0.7918 mL | |
| 15 mM | 0.0211 mL | 0.1056 mL | 0.2111 mL | 0.5279 mL | |
| 20 mM | 0.0158 mL | 0.0792 mL | 0.1584 mL | 0.3959 mL | |
| 25 mM | 0.0127 mL | 0.0633 mL | 0.1267 mL | 0.3167 mL | |
| 30 mM | 0.0106 mL | 0.0528 mL | 0.1056 mL | 0.2639 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.