1. GPCR/G Protein
  2. Neuropeptide Y Receptor

Galanin (1-30), human 

Cat. No.: HY-P1127
Handling Instructions

Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Galanin (1-30), human Chemical Structure

Galanin (1-30), human Chemical Structure

CAS No. : 119418-04-1

Size Price Stock
500 μg USD 140 Get quote
1 mg USD 240 Get quote
5 mg USD 940 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • References

Description

Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM. Sequence: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS.

IC50 & Target

Kd: 1 nM (GalR1 receptor), 1 nM (GalR2 receptor)[2]

In Vitro

Galanin (1-30), human (Gal1-30) is an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM[1]. Galanin (1-30), human displaces 125I-labeled rat galanin with a Kd of 0.5 nM. Galanin (1-30), human (hGal) causes contractions of isolated longitudinal rat fundus strips, with an ED50 of 13.8 ± 1.6 nM[2].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3167 mL 1.5836 mL 3.1671 mL
5 mM 0.0633 mL 0.3167 mL 0.6334 mL
10 mM 0.0317 mL 0.1584 mL 0.3167 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

3157.46

Formula

C₁₃₉H₂₁₀N₄₂O₄₃

CAS No.

119418-04-1

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galanin (1-30), human
Cat. No.:
HY-P1127
Quantity:

Galanin (1-30), human

Cat. No.: HY-P1127