Galanin (1-30), human  (Synonyms: Glanin)

Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with K_is of both 1 nM.

Kd: 1 nM (GalR1 receptor), 1 nM (GalR2 receptor)^[2]

Galanin (1-30), human (Gal_1-30) is an agonist of GalR1 and GalR2 receptors, with K_is of both 1 nM^[1]. Galanin (1-30), human displaces ¹²⁵I-labeled rat galanin with a K_d of 0.5 nM. Galanin (1-30), human (hGal) causes contractions of isolated longitudinal rat fundus strips, with an ED₅₀ of 13.8 ± 1.6 nM^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3157.46

C₁₃₉H₂₁₀N₄₂O₄₃

119418-04-1

Solid

White to off-white

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

• [1]. Hua XY, et al. Galanin acts at GalR1 receptors in spinal antinociception: synergy with morphine and AP-5. J Pharmacol Exp Ther. 2004 Feb;308(2):574-82.  [Content Brief]

  [2]. Schmidt WE, et al. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11435-9.  [Content Brief]