1. GPCR/G Protein
  2. GCGR
  3. GLP-1(7-36), amide

GLP-1(7-36), amide  (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide)

Cat. No.: HY-P0054A Purity: 99.02%
Handling Instructions Technical Support

GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 107444-51-9

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 9 publication(s) in Google Scholar

Other Forms of GLP-1(7-36), amide:

Top Publications Citing Use of Products

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968.  [Abstract]

    GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca2+ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425.  [Abstract]

    TB-59-2 is a potent agonist in the cAMP assay with a similar EC50 as the GLP-1(7-36), amide acetate (30 min) peptide.

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425.  [Abstract]

    TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.

    GLP-1(7-36), amide purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.
    • Biological Activity

    • Protocol

    • Purity & Documentation

    • References

    • Customer Review

    Description

    GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

    In Vitro

    The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum[2].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    In Vivo

    Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration[4].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Molecular Weight

    3297.68

    Formula

    C149H226N40O45

    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

    Sequence Shortening

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvent & Solubility
    In Vitro: 

    H2O : 100 mg/mL (30.32 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.3032 mL 1.5162 mL 3.0324 mL
    5 mM 0.0606 mL 0.3032 mL 0.6065 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation

    Purity: 99.90%

    References

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.3032 mL 1.5162 mL 3.0324 mL 7.5811 mL
    5 mM 0.0606 mL 0.3032 mL 0.6065 mL 1.5162 mL
    10 mM 0.0303 mL 0.1516 mL 0.3032 mL 0.7581 mL
    15 mM 0.0202 mL 0.1011 mL 0.2022 mL 0.5054 mL
    20 mM 0.0152 mL 0.0758 mL 0.1516 mL 0.3791 mL
    25 mM 0.0121 mL 0.0606 mL 0.1213 mL 0.3032 mL
    30 mM 0.0101 mL 0.0505 mL 0.1011 mL 0.2527 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    GLP-1(7-36), amide
    Cat. No.:
    HY-P0054A
    Quantity:
    MCE Japan Authorized Agent: