1. GPCR/G Protein
  2. Glucagon Receptor

Lixisenatide 

Cat. No.: HY-P0119 Purity: 98.36%
Handling Instructions

Lixisenatide inhibit glucagon release, markedly reduce postprandial glucago.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Lixisenatide Chemical Structure

Lixisenatide Chemical Structure

CAS No. : 320367-13-3

Size Price Stock Quantity
10 mM * 1 mL in Water USD 5291 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
1 mg USD 220 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
5 mg USD 660 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
10 mg USD 990 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Preparing Stock Solutions
Concentration Volume Mass 1 mg 5 mg 10 mg
1 mM 0.2058 mL 1.0291 mL 2.0583 mL
5 mM 0.0412 mL 0.2058 mL 0.4117 mL
10 mM 0.0206 mL 0.1029 mL 0.2058 mL
Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

4858.49

Formula

C₂₁₅H₃₄₇N₆₁O₆₅S

CAS No.

320367-13-3

SMILES

[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK]

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

Solvent & Solubility

H2O: 106 mg/mL

* "<1 mg/mL" means slightly soluble or insoluble. "≥" means soluble, but saturation unknown.

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lixisenatide
Cat. No.:
HY-P0119
Quantity: