2. GPCR/G Protein Neuronal Signaling Membrane Transporter/Ion Channel
  3. Natriuretic Peptide Receptor (NPR) Calcium Channel
  4. Nesiritide

Nesiritide  (Synonyms: Brain Natriuretic Peptide-32 human; BNP-32)

Art. -Nr.: HY-P0003 Reinheit: 99.75%
COA
SDS
Handling Instructions Technical Support

Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

Nesiritide

Nesiritide Chemische Struktur

CAS. Nr. : 124584-08-3

Größe Preis Verfügbarkeit Menge
1 mg Auf Lager
5 mg Auf Lager
10 mg Auf Lager
50 mg   Angebot einholen  
100 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Kundenbewertung

Based on 1 Customer Validation

Other Forms of Nesiritide:

Nesiritide Related Antibodies

Top Publications Citing Use of Products

Alle Calcium Channel Isoform-spezifische Produkte anzeigen:

Alle Isoformen anzeigen
N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

  • Biologische Aktivität

  • Reinheit & Dokumentation

  • Verweise

  • Kundenbewertung

Beschreibung

Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury[1][2][3][4][5][6][7].

IC50 & Target

Kd: 7.3 Pm (NPR-A), 13 pM (NPR-C)[1].
In Vitro

Nesiritide (1 nM-1 μM) significantly decreases cell shortening in ventricular myocytes isolated from rat hearts in a dose-dependent manner[1].
Nesiritide (1 μM) increases the V1/2 activation of the L-type calcium channel by 51.1% and decreases V1/2 inactivation by 31.8% in ventricular myocytes isolated from rat hearts[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Nesiritide Related Antibodies
In Vivo

Nesiritide (2 μg/kg i.v. bolus followed by 0.01 μg/kg/min i.v. infusion) reduces infarct size, preserves endothelial function, and lessens lung edema in a porcine model of acute coronary occlusion simulating urgent CABG surgery[2].
Nesiritide (0.1 mg/kg/day; s.c.; once daily; 4 weeks) protects endothelial function after balloon-induced trauma in the iliac artery in rabbits[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male rabbits (weight 2.3 kg, median age 5 months) with iliac artery endothelial trauma[3]
Dosage: 0.1 mg/kg/day (diluted with normal saline)
Administration: Subcutaneous injection, once daily for 4 weeks
Result: Inhibited remodeling of rabbit iliac artery following endothelial trauma.
Reduced plasma levels of ET-1 and vWF.
Increased plasma level of NO, and decreased the ratio of PCNA positive expression.
Molekulargewicht

3464.04

Formel

C143H244N50O42S4
CAS. Nr.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26)
Sequence Shortening

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)
Versand

Room temperature in continental US; may vary elsewhere.
Speicherung

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Lösungsmittel & Löslichkeit
In Vitro: 

H2O : 100 mg/mL (28.87 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2887 mL 1.4434 mL 2.8868 mL
5 mM 0.0577 mL 0.2887 mL 0.5774 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molaritätsrechner

  • Verdünnungsrechner

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  PBS

    Solubility: 100 mg/mL (28.87 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Reinheit & Dokumentation

Purity: 99.75%

SDS (252 KB)

COA (242 KB) RP-HPLC (254 KB) MS (150 KB) Elemental Analysis Report (99 KB)

Handling Instructions (2659 KB)
Verweise

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2887 mL 1.4434 mL 2.8868 mL 7.2170 mL
5 mM 0.0577 mL 0.2887 mL 0.5774 mL 1.4434 mL
10 mM 0.0289 mL 0.1443 mL 0.2887 mL 0.7217 mL
15 mM 0.0192 mL 0.0962 mL 0.1925 mL 0.4811 mL
20 mM 0.0144 mL 0.0722 mL 0.1443 mL 0.3609 mL
25 mM 0.0115 mL 0.0577 mL 0.1155 mL 0.2887 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Nesiritide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Nesiritide124584-08-3Brain Natriuretic Peptide-32 human BNP-32BNP32BNP 32BNP-32Natriuretic Peptide Receptor (NPR)Calcium ChannelNatriuretic Peptide ReceptorNPRNPR-ANPR-BNPR-CCa2+ channelsCa channelsNPRsnatriuretic peptide receptoracute coronary occlusionrabbitsventricular myocytesInhibitorinhibitorinhibit

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Produktname

  

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

      

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Nesiritide
Art. -Nr.:
HY-P0003
Menge:
MCE Japan Authorized Agent:

Kundenbewertung

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Produktname

  

Lot #

Name des Antragstellers *

 

E-Mail-Addresse *

Telefonnummer

 

Department *

Name der Organisation *

 

Country or Region *

Bemerkungen

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.