2. Anti-infection
  3. Bacterial
  4. Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) 

Cat. No.: HY-P1459
Handling Instructions

Molarity Calculator

Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Chemical Structure

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.

IC50 & Target

Bacterial[1]
In Vitro

Sphistin is a synthetic 38-amino acid H2A derived peptide from Scylla paramamosain. Sphistin Synthetic Peptide (12-38) shows a stronger activity with a much lower minimum inhibitory concentration (3 mM) against Staphylococcus aureus, Corynebacterium glutamicum, Micrococcus lysodeikticus Fleming, Bacillus subtilis, Pseudomonas fluorescens, Aeromonas hydrophila and A. sobria in comparison with the reported Sphistin. A leakage of intracellular content is described in E. coli treated with Sphistin Synthetic Peptide (12-38). Unlike Sphistin which mainly disrupts the membrane integrity, Sphistin Synthetic Peptide (12-38) could also combine the A. sobria genomic DNA with a minimum concentration of 6 mM and is located intracellularly in cells observed under confocal laser scanning microscope imaging[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Related Antibodies
In Vivo

In comparison with the control group of Oryzias melastigma injected with A. sobria alone, the group treated with a mixture of Synthetic Peptide (12-38) and A. sobria shows a higher survival rate 7 days post-injection. Furthermore, in a pretreatment assay at 6 h, a higher survival rate is observed in the group injected with the mixture of Synthetic Peptide (12-38) and A. sobria[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight

3372.91

Formula

C153H239N49O36S
Appearance

Solid

Color

Orange to red

Sequence

FITC--Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys
Sequence Shortening

FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
Cell Assay
[1]

Sphistin Synthetic Peptide (12-38) is diluted to final concentrations from 1.5 mM to 96 mM with Milli-Q sterilized water.The microorganisms are diluted with 10 mM phosphate buffer (PBS, pH 7.4) to 3.3×104 cfu/mL and incubated with serial dilutions of truncated peptides. Samples without peptides are considered as blanks. After 20 h (40 h for yeast) of incubation at 30 C, the MIC at which the lowest concentration of peptide inhibiting growth of the organisms is determined. Then the cultures are plated on appropriate agar and the minimum bactericidal concentration (MBC) value, which is the least concentration showing no bacterial growth after incubation at room temperature for 24-48 h, is recorded. All the values are averaged using three independent measurements[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)BacterialInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)
Cat. No.:
HY-P1459
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.