Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)
Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
For research use only. We do not sell to patients.
- Formula: C153H239N49O36S
- Molecular Weight:3372.91
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocol
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Bacterial[1]
Sphistin is a synthetic 38-amino acid H2A derived peptide from Scylla paramamosain. Sphistin Synthetic Peptide (12-38) shows a stronger activity with a much lower minimum inhibitory concentration (3 mM) against Staphylococcus aureus, Corynebacterium glutamicum, Micrococcus lysodeikticus Fleming, Bacillus subtilis, Pseudomonas fluorescens, Aeromonas hydrophila and A. sobria in comparison with the reported Sphistin. A leakage of intracellular content is described in E. coli treated with Sphistin Synthetic Peptide (12-38). Unlike Sphistin which mainly disrupts the membrane integrity, Sphistin Synthetic Peptide (12-38) could also combine the A. sobria genomic DNA with a minimum concentration of 6 mM and is located intracellularly in cells observed under confocal laser scanning microscope imaging[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3372.91
-
Formula C153H239N49O36S
-
Color Orange to red
-
Sequence
FITC--Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys
-
Sequence Shortening
FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Protocol
Sphistin Synthetic Peptide (12-38) is diluted to final concentrations from 1.5 mM to 96 mM with Milli-Q sterilized water.The microorganisms are diluted with 10 mM phosphate buffer (PBS, pH 7.4) to 3.3×104 cfu/mL and incubated with serial dilutions of truncated peptides. Samples without peptides are considered as blanks. After 20 h (40 h for yeast) of incubation at 30 C, the MIC at which the lowest concentration of peptide inhibiting growth of the organisms is determined. Then the cultures are plated on appropriate agar and the minimum bactericidal concentration (MBC) value, which is the least concentration showing no bacterial growth after incubation at room temperature for 24-48 h, is recorded. All the values are averaged using three independent measurements[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Related Classifications
HY-P1459 Related Classifications
Powered by Bioz