Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

Cat. No.: HY-P1459: Ficha de datos
SDS
Instrucciones de manejo
FAQs
Technical Support

Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.

Para uso exclusivo en investigación. No vendemos a pacientes.

Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) Estructura química

Tamaño		Stock
MOQ		Minimum order quantity
50 mg		Obtener un presupuesto
100 mg		Obtener un presupuesto
250 mg		Obtener un presupuesto
Other size		Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Recomendaciones destacadas

•Related Small Molecules:

•Related Proteins:

Actividad biológica
Protocolo
Pureza y Documentación
Referencias
Revisión del cliente

Descripciòn

Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.

IC₅₀ & Target

Bacterial^[1]

In Vitro

Sphistin is a synthetic 38-amino acid H2A derived peptide from Scylla paramamosain. Sphistin Synthetic Peptide (12-38) shows a stronger activity with a much lower minimum inhibitory concentration (3 mM) against Staphylococcus aureus, Corynebacterium glutamicum, Micrococcus lysodeikticus Fleming, Bacillus subtilis, Pseudomonas fluorescens, Aeromonas hydrophila and A. sobria in comparison with the reported Sphistin. A leakage of intracellular content is described in E. coli treated with Sphistin Synthetic Peptide (12-38). Unlike Sphistin which mainly disrupts the membrane integrity, Sphistin Synthetic Peptide (12-38) could also combine the A. sobria genomic DNA with a minimum concentration of 6 mM and is located intracellularly in cells observed under confocal laser scanning microscope imaging^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In comparison with the control group of Oryzias melastigma injected with A. sobria alone, the group treated with a mixture of Synthetic Peptide (12-38) and A. sobria shows a higher survival rate 7 days post-injection. Furthermore, in a pretreatment assay at 6 h, a higher survival rate is observed in the group injected with the mixture of Synthetic Peptide (12-38) and A. sobria^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Peso molecular

3372.91

Fòrmula

C₁₅₃H₂₃₉N₄₉O₃₆S

Appearance

Solid

Color

Orange to red

Sequence

FITC--Lys-Ala-Lys-Ala-Lys-Ala-Val-Ser-Arg-Ser-Ala-Arg-Ala-Gly-Leu-Gln-Phe-Pro-Val-Gly-Arg-Ile-His-Arg-His-Leu-Lys

Sequence Shortening

FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Pureza y Documentación

Ficha de datos (264 KB) SDS (252 KB) Instrucciones de manejo (2659 KB)

Referencias

[1]. Ma XW, et al. A truncated Sph12-38 with potent antimicrobial activity showing resistance against bacterial challenge in Oryzias melastigma. Fish Shellfish Immunol. 2017 Aug;67:561-570. [Content Brief]

Ensayo celular
^[1]

Sphistin Synthetic Peptide (12-38) is diluted to final concentrations from 1.5 mM to 96 mM with Milli-Q sterilized water.The microorganisms are diluted with 10 mM phosphate buffer (PBS, pH 7.4) to 3.3×10⁴ cfu/mL and incubated with serial dilutions of truncated peptides. Samples without peptides are considered as blanks. After 20 h (40 h for yeast) of incubation at 30 C, the MIC at which the lowest concentration of peptide inhibiting growth of the organisms is determined. Then the cultures are plated on appropriate agar and the minimum bactericidal concentration (MBC) value, which is the least concentration showing no bacterial growth after incubation at room temperature for 24-48 h, is recorded. All the values are averaged using three independent measurements^[1].

MCE no ha confirmado la precisión de estos métodos independientemente. Son solo para referencia.

Referencias

[1]. Ma XW, et al. A truncated Sph12-38 with potent antimicrobial activity showing resistance against bacterial challenge in Oryzias melastigma. Fish Shellfish Immunol. 2017 Aug;67:561-570. [Content Brief]