Urotensin I
Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 83930-33-0
- Formel: C210H340N62O67S2
- Molecular Weight:4869.46
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
IC50 & Target
pEC50: 11.46 (human CRF1, CHO cells), 9.36 (human CRF2, CHO cells), 9.85 (rat CRF2α, CHO cells)[1]
Ki: 0.4 nM (hCRF1, cell assay), 1.8 nM (rCRF2α, cell assay), and 5.7 nM (mCRF2β, cell assay)[2]
In Vitro
Urotensin I is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column[3].
Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I (UI). At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I, the content of cAMP increased significantly[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS. Nr. 83930-33-0
-
Molecular Weight 4869.46
-
Formel C210H340N62O67S2
-
Synonyms
Catostomus urotensin I
-
Sequence
Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
-
Sequence Shortening
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [Content Brief]
[2]. Reul JM, et al. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr Opin Pharmacol. 2002 Feb;2(1):23-33. [Content Brief]
[3]. Fryer J, et al. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Endocrinology. 1983;113(6):2308-2310. [Content Brief]
[4]. Gerritsen ME, et al. Urotensin I effects on intracellular content of cyclic AMP in the rat tail artery. Eur J Pharmacol. 1979;60(2-3):211-220. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)