1. GPCR/G Protein
  2. CRFR

Urotensin I (Synonyms: Catostomus urotensin I)

Cat. No.: HY-P1542
Handling Instructions

Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF and mCRF receptors, respectively. Sequence: Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2;NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urotensin I Chemical Structure

Urotensin I Chemical Structure

CAS No. : 83930-33-0

Size Price Stock
500 μg USD 260 Get quote
1 mg USD 450 Get quote
5 mg USD 1350 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF and mCRF receptors, respectively. Sequence: Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2;NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2.

IC50 & Target

pEC50: 11.46 (human CRF1, CHO cells), 9.36 (human CRF2, CHO cells), 9.85 (rat CRF, CHO cells)[1]
Ki: 0.4 nM (hCRF1, cell assay), 1.8 nM (rCRF, cell assay), and 5.7 nM (mCRF, cell assay)[2]

In Vitro

Urotensin I is a 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF receptors in CHO cells[1] and with Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF and mCRF receptors in cell assay, respectively[2]. Urotensin I exhibits a striking sequence homology with ovine corticotropin-releasing factor and with frog sauvagine, and has potent hypotensive activity and corticotropin-releasing activity[3]. Urotensin I stimulates the release of ACTH from an isolated dispersed goldfish anterior pituitary cell column[4].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2054 mL 1.0268 mL 2.0536 mL
5 mM 0.0411 mL 0.2054 mL 0.4107 mL
10 mM 0.0205 mL 0.1027 mL 0.2054 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

4869.46

Formula

C₂₁₀H₃₄₀N₆₂O₆₇S₂

CAS No.

83930-33-0

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Urotensin I
Cat. No.:
HY-P1542
Quantity:

Urotensin I

Cat. No.: HY-P1542