Urotensin I TFA
Based on 1 Customer Validation
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.
For research use only. We do not sell to patients.
- Purity : 95.77%
- Formula: C210H340N62O67S2.xC2HF3O2
- Molecular Weight:4869.46 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
IC50 & Target
pEC50: 11.46 (human CRF1, CHO cells), 9.36 (human CRF2, CHO cells), 9.85 (rat CRF2α, CHO cells)[1]
Ki: 0.4 nM (hCRF1, cell assay), 1.8 nM (rCRF2α, cell assay), and 5.7 nM (mCRF2β, cell assay)[2]
In Vitro
Urotensin I is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column[3].
Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I (UI). At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I, the content of cAMP increased significantly[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4869.46 (free base)
-
Formula C210H340N62O67S2.xC2HF3O2
-
Color White to off-white
-
Synonyms
Catostomus urotensin I TFA
-
Sequence
Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2
-
Sequence Shortening
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [Content Brief]
[2]. Reul JM, et al. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr Opin Pharmacol. 2002 Feb;2(1):23-33. [Content Brief]
[3]. Fryer J, et al. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Endocrinology. 1983;113(6):2308-2310. [Content Brief]
[4]. Gerritsen ME, et al. Urotensin I effects on intracellular content of cyclic AMP in the rat tail artery. Eur J Pharmacol. 1979;60(2-3):211-220. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)