Adrenomedullin (AM) (22-52), human TFA  (Synonyms: 22-52-Adrenomedullin (human) (TFA))

Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH₂ terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat^[1].

Adrenomedullin receptor, CGRP receptor^[1]

Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist^[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3576.04 (free base)

C₁₅₉H₂₅₂N₄₆O₄₈.xC₂HF₃O₂

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol. 1997 Jan;272(1 Pt 2):R234-42.  [Content Brief]

  [2]. Ziolkowska A, et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med. 2003 May;11(5):613-5.  [Content Brief]