Adrenomedullin (AM) (22-52), human TFA
Based on 4 publication(s) in Google Scholar
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
For research use only. We do not sell to patients.
- Formula: C159H252N46O48.xC2HF3O2
- Molecular Weight:3575.98 (free base)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Adrenomedullin (AM) (22-52), human TFA
More
Biological Activity
Description
IC50 & Target
Adrenomedullin receptor, CGRP receptor[1]
In Vitro
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 3575.98 (free base)
-
Formula C159H252N46O48.xC2HF3O2
-
Synonyms
22-52-Adrenomedullin (human) TFA
-
Sequence
Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
-
Sequence Shortening
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (4)
-
Journal Impact Factor
-
Most Recent
-
Nature
2026 Apr;652(8112):1298-1307. PMID: 41708857 -
Neuron
METTL14 integrates tumor-derived SAM to drive parabrachial epigenetic rewiring in pancreatic cancer. [Abstract]2025 Nov 4:S0896-6273(25)00755-X. PMID: 41192426 -
Proc Natl Acad Sci U S A
A time-gated PKA-CREB signaling circuit licenses IL-12 responsiveness and Th1 fate in CD4+ T cells. [Abstract]2025 Oct 14;122(41):e2517132122. PMID: 41052344 -
Int Dent J
The Immune Regulatory Mechanism of Adrenomedullin on Promoting the Proliferation and Differentiation of Dental Pulp Stem Cells. [Abstract]2024 Dec;74(6):1386-1396. PMID: 38806333
Purity & Documentation
References
[1]. Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol. 1997 Jan;272(1 Pt 2):R234-42. [Content Brief]
[2]. Ziolkowska A, et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med. 2003 May;11(5):613-5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)