1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor
  3. Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human (Synonyms: 22-52-Adrenomedullin (human))

Cat. No.: HY-P1471 Purity: 98.78%
Handling Instructions

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (AM) (22-52), human Chemical Structure

Adrenomedullin (AM) (22-52), human Chemical Structure

CAS No. : 159899-65-7

Size Price Stock Quantity
500 μg USD 140 In-stock
Estimated Time of Arrival: December 31
1 mg USD 240 In-stock
Estimated Time of Arrival: December 31
5 mg USD 960 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenomedullin (AM) (22-52), human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2].

IC50 & Target

Adrenomedullin receptor, CGRP receptor[1]

In Vitro

Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].

Molecular Weight

3576.04

Formula

C₁₅₉H₂₅₂N₄₆O₄₈

CAS No.

159899-65-7

Sequence

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

Sequence Shortening

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Adrenomedullin (AM) (22-52), human22-52-Adrenomedullin (human)CGRP ReceptorCalcitonin gene-related peptide receptoradrenomedullinreceptorcalcitoninpeptideCGRPhindlimbvascularbedcAMPaccumulationsmoothmuscleInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (AM) (22-52), human
Cat. No.:
HY-P1471
Quantity:
MCE Japan Authorized Agent: