1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor
  3. Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human (Synonyms: 22-52-Adrenomedullin (human))

Cat. No.: HY-P1471
Handling Instructions

Adrenomedullin (AM) (22-52), human is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (AM) (22-52), human Chemical Structure

Adrenomedullin (AM) (22-52), human Chemical Structure

CAS No. : 159899-65-7

Size Price Stock
500 μg USD 140 Ask For Quote & Lead Time
1 mg USD 240 Ask For Quote & Lead Time
5 mg USD 960 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenomedullin (AM) (22-52), human is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

IC50 & Target

Adrenomedullin receptor, CGRP receptor[1]

In Vitro

Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].

Molecular Weight

3576.04

Formula

C₁₅₉H₂₅₂N₄₆O₄₈

CAS No.

159899-65-7

Sequence

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

Sequence Shortening

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (AM) (22-52), human
Cat. No.:
HY-P1471
Quantity: