2. GPCR/G Protein Neuronal Signaling
  3. CGRP Receptor
  4. Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human  (Synonyms: 22-52-Adrenomedullin (human))

Cat. No.: HY-P1471 Purity: 99.91%
COA Handling Instructions

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (AM) (22-52), human Chemical Structure

Adrenomedullin (AM) (22-52), human Chemical Structure

CAS No. : 159899-65-7

Size Price Stock Quantity
500 μg USD 140 In-stock
1 mg USD 240 In-stock
5 mg USD 960 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenomedullin (AM) (22-52), human:

Adrenomedullin (AM) (22-52), human Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2].

IC50 & Target

Adrenomedullin receptor, CGRP receptor[1]
In Vitro

Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Adrenomedullin (AM) (22-52), human Related Antibodies
Molecular Weight

3576.04

Appearance

Solid

Formula

C159H252N46O48
CAS No.
Sequence

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Sequence Shortening

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (27.96 mM; Need ultrasonic)

H2O : 50 mg/mL (13.98 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2796 mL 1.3982 mL 2.7964 mL
5 mM 0.0559 mL 0.2796 mL 0.5593 mL
10 mM 0.0280 mL 0.1398 mL 0.2796 mL
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation

Purity: 99.91%

COA (243 KB) LCMS (86 KB)

Handling Instructions (2659 KB)
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Adrenomedullin (AM) (22-52), human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Adrenomedullin (AM) (22-52), human159899-65-722-52-Adrenomedullin (human)CGRP ReceptorCalcitonin gene-related peptide receptoradrenomedullinreceptorcalcitoninpeptideCGRPhindlimbvascularbedcAMPaccumulationsmoothmuscleInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (AM) (22-52), human
Cat. No.:
HY-P1471
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.