Adrenomedullin (AM) (22-52), human
Based on 4 publication(s) in Google Scholar
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
For research use only. We do not sell to patients.
- Purity: 99.61%
- CAS No.: 159899-65-7
- Formula: C159H252N46O48
- Molecular Weight:3575.98
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Adrenomedullin (AM) (22-52), human
More
Biological Activity
Description
IC50 & Target
Adrenomedullin receptor, CGRP receptor[1]
In Vitro
Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 159899-65-7
-
Appearance Solid
-
Molecular Weight 3575.98
-
Formula C159H252N46O48
-
Color White to off-white
-
Synonyms
22-52-Adrenomedullin (human)
-
Sequence
Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
-
Sequence Shortening
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (4)
-
Journal Impact Factor
-
Most Recent
-
Nature
2026 Apr;652(8112):1298-1307. PMID: 41708857 -
Neuron
METTL14 integrates tumor-derived SAM to drive parabrachial epigenetic rewiring in pancreatic cancer. [Abstract]2025 Nov 4:S0896-6273(25)00755-X. PMID: 41192426 -
Proc Natl Acad Sci U S A
A time-gated PKA-CREB signaling circuit licenses IL-12 responsiveness and Th1 fate in CD4+ T cells. [Abstract]2025 Oct 14;122(41):e2517132122. PMID: 41052344 -
Int Dent J
The Immune Regulatory Mechanism of Adrenomedullin on Promoting the Proliferation and Differentiation of Dental Pulp Stem Cells. [Abstract]2024 Dec;74(6):1386-1396. PMID: 38806333
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (27.96 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : 50 mg/mL (13.98 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (282 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Champion HC, et al. Adrenomedullin-(22-52) antagonizes vasodilator responses to CGRP but not adrenomedullin in the cat. Am J Physiol. 1997 Jan;272(1 Pt 2):R234-42. [Content Brief]
[2]. Ziolkowska A, et al. Effects of adrenomedullin and its fragment 22-52 on basal and ACTH-stimulated secretion of cultured rat adrenocortical cells. Int J Mol Med. 2003 May;11(5):613-5. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2796 mL | 1.3982 mL | 2.7964 mL | 6.9911 mL |
| 5 mM | 0.0559 mL | 0.2796 mL | 0.5593 mL | 1.3982 mL | |
| 10 mM | 0.0280 mL | 0.1398 mL | 0.2796 mL | 0.6991 mL | |
| DMSO | 15 mM | 0.0186 mL | 0.0932 mL | 0.1864 mL | 0.4661 mL |
| 20 mM | 0.0140 mL | 0.0699 mL | 0.1398 mL | 0.3496 mL | |
| 25 mM | 0.0112 mL | 0.0559 mL | 0.1119 mL | 0.2796 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.