1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Ceratotoxin-1

Ceratotoxin-1  (Synonyms: CcoTx1; β-TRTX-cm1a)

Cat. No.: HY-P5811
Handling Instructions

Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Ceratotoxin-1 Chemical Structure

Ceratotoxin-1 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1[1].

IC50 & Target[1]

Nav1.1

523 nM (IC50)

Nav1.2

3 nM (IC50)

Nav1.4

888 nM (IC50)

Nav1.5

323 nM (IC50)

Nav1.8

 

Molecular Weight

4044.58

Formula

C172H256N52O50S6

Sequence

Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Asp-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)

Sequence Shortening

DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Ceratotoxin-1 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ceratotoxin-1
Cat. No.:
HY-P5811
Quantity:
MCE Japan Authorized Agent: