1. Peptides
  2. LL-37, Human TFA

LL-37, Human TFA 

Cat. No.: HY-P1222A
Handling Instructions

LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, Human TFA Chemical Structure

LL-37, Human TFA Chemical Structure

Size Price Stock Quantity
10 mM * 1 mL in DMSO USD 9224 In-stock
Estimated Time of Arrival: December 31
1 mg USD 260 In-stock
Estimated Time of Arrival: December 31
5 mg USD 910 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of LL-37, Human TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity[1]. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing[2].

Storage
Powder -20°C 3 years
In solvent -80°C 6 months
  -20°C 1 month
References
Molecular Weight

4607.28

Formula

C₂₀₅H₃₄₀N₆₀O₅₃.C₂HF₃O₂

Sequence

{Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser}

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37, Human TFA
Cat. No.:
HY-P1222A
Quantity:

LL-37, Human TFA

Cat. No.: HY-P1222A