2. Anti-infection
  3. Bacterial
  4. LL-37, human TFA

LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg In-stock
100 mg In-stock
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 6 publication(s) in Google Scholar

Other Forms of LL-37, human TFA:

LL-37, human TFA Related Antibodies

Top Publications Citing Use of Products
2D/3D Cell Culture and Differentiation
In Vivo Efficacy Study
RT-PCR
Cell Imaging/Staining
Histological Imaging/Staining
Cell Migration/Invasion Assay
ELISA
Bio/Physico-chemical Assay

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) showed no cytotoxicity to HaCaT and HDF cells.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) demonstrated effective photodamage repair, increasing the survival of UVB-irradiated HaCaT cells by 14.6% and UVA-irradiated HDF cells by 11.8%.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) reduced ROS levels in UVB-irradiated HaCaT cells and UVA-irradiated HDF cells.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 12 h) increased the migration rate of HaCaT cells.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) mitigated MGO-induced AGE formation in HaCaT cells.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) suppressed α-MSH-induced melanin production in HaCaT cells.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) generated the redness and telangiectasis in the skin of BALB/c mice, with increased range of redness and the redness score.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) elevated the levels of IL-6, TNF-α, IL-1α, and VEGF in BALB/c mice tissues.

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    The present study employed OCT to examine the structural characteristics of the skin of BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    ELISA analysis of IL-17, CCL-3, CXCL-15 level in BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).

    LL-37, human TFA purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) caused a statistically significant increase in the presence of CD4+T cells and MCs within the dermis of BALB/c mice.

    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing[1][2][3].

    In Vitro

    LL-37, human TFA (1-20 μg/mL; 24 h) affects HCECs migration[2].
    LL-37, human TFA (0.0001-5 μg/mL; 6-24 h) affects cytokine secretion in HCECs[2].
    LL-37, human TFA (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    LL-37, human TFA Related Antibodies

    Cell Migration Assay [2]

    Cell Line: Human corneal epithelial cell (HCEC)
    Concentration: 1, 2.5, 5, 10 and 20 μg/mL
    Incubation Time: 24 hours
    Result: Dose-dependently stimulated HCECs migration but showed no effect on cells proliferation.

    Cell Viability Assay[2]

    Cell Line: Human corneal epithelial cell (HCEC)
    Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
    Incubation Time: 6 and 24 hours
    Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCECs.
    In Vivo

    LL-37, human TFA (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
    Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
    Administration: Intratracheal injection; 0.4-2.0 mg/kg once
    Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
    Molecular Weight

    4493.26 (free base)

    Formula

    C205H340N60O53.xC2HF3O2
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
    Sequence Shortening

    [LL-37, 37 aa]
    Shipping

    Room temperature in continental US; may vary elsewhere.
    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvent & Solubility
    In Vitro: 

    H2O : 100 mg/mL (Need ultrasonic)

    DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo:

    For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
    The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

    • Protocol 1

      Add each solvent one by one:  PBS

      Solubility: 16.67 mg/mL; Clear solution; Need ultrasonic

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation

    Purity: 99.96%

    SDS (252 KB)

    COA (264 KB) RP-HPLC (267 KB) MS (70 KB)

    Handling Instructions (2659 KB)
    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.

    LL-37, human TFA Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Keywords:

    LL-37, humanBacterial37-residuecathelicidin-derivedpeptidebroad spectrumcorneaHCECintratracheal injectionInhibitorinhibitorinhibit

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Requested Quantity *

    Applicant Name *

    		 

    Salutation

    Email Address *

    		 

    Phone Number *

    Department

    		 

    Organization Name *

    City

    State

    Country or Region *

    		      

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    LL-37, human TFA
    Cat. No.:
    HY-P1222A
    Quantity:
    MCE Japan Authorized Agent:

    Customer Review

    Thank You for Your Feedback!

    Request for HNMR Report

    Please fill out this form to request the QC report. We will send it to your Email address shortly.

    Your information is safe with us. * Required Fields.

    Product Name

    		  

    Lot #

    Applicant Name *

    		 

    Email Address *

    Phone Number

    		 

    Department *

    Organization Name *

    		 

    Country or Region *

    Remarks

    SAFETY DATA SHEET (SDS)

    English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

    Request for HNMR Report

    We have received your request and will respond to you as soon as possible.