1. Anti-infection
  2. Bacterial
  3. LL-37, human TFA

LL-37, human TFA 

Cat. No.: HY-P1222A Purity: 99.71%
Handling Instructions

LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, human TFA Chemical Structure

LL-37, human TFA Chemical Structure

Size Price Stock Quantity
1 mg USD 125 In-stock
Estimated Time of Arrival: December 31
5 mg USD 260 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of LL-37, human TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE LL-37, human TFA

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity[1]. LL-37, human TFA could help protect the cornea from infection and modulates wound healing[2].

Molecular Weight

4607.28

Formula

C205H340N60O53.C2HF3O2

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (21.70 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2170 mL 1.0852 mL 2.1705 mL
5 mM 0.0434 mL 0.2170 mL 0.4341 mL
10 mM 0.0217 mL 0.1085 mL 0.2170 mL
*Please refer to the solubility information to select the appropriate solvent.
References

Purity: 99.71%

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37, human TFA
Cat. No.:
HY-P1222A
Quantity:
MCE Japan Authorized Agent: