1. Anti-infection
  2. Bacterial
  3. LL-37, human acetate

LL-37, human acetate 

Cat. No.: HY-P1222B Purity: 99.96%
COA Handling Instructions

LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, human acetate Chemical Structure

LL-37, human acetate Chemical Structure

Size Price Stock Quantity
1 mg USD 125 In-stock
5 mg USD 260 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of LL-37, human acetate:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE LL-37, human acetate

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing[1][2][3].

In Vitro

LL-37, human acetate (1-20 μg/mL; 24 h) affects HCECs migration[2].
LL-37, human acetate (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].
LL-37, human acetate (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Migration Assay [2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 1, 2.5, 5, 10 and 20 μg/mL
Incubation Time: 24 hours
Result: Dose-dependently stimulated HCEC migration but showed no effect on cells proliferation.

Cell Viability Assay[2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
Incubation Time: 6 and 24 hours
Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
In Vivo

LL-37, human acetate (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
Administration: Intratracheal injection; 0.4-2.0 mg/kg once
Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
Molecular Weight

4553.31

Appearance

Solid

Formula

C207H344N60O55

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (21.96 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2196 mL 1.0981 mL 2.1962 mL
5 mM 0.0439 mL 0.2196 mL 0.4392 mL
10 mM 0.0220 mL 0.1098 mL 0.2196 mL
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation

Purity: 99.96%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37, human acetate
Cat. No.:
HY-P1222B
Quantity:
MCE Japan Authorized Agent: