1. Anti-infection
  2. Bacterial
  3. LL-37, human

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 154947-66-7

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 6 publication(s) in Google Scholar

Other Forms of LL-37, human:

Top Publications Citing Use of Products
2D/3D Cell Culture and Differentiation
In Vivo Efficacy Study
RT-PCR
Cell Imaging/Staining
Histological Imaging/Staining
Cell Migration/Invasion Assay
ELISA
Bio/Physico-chemical Assay

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) showed no cytotoxicity to HaCaT and HDF cells.

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) demonstrated effective photodamage repair, increasing the survival of UVB-irradiated HaCaT cells by 14.6% and UVA-irradiated HDF cells by 11.8%.

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) reduced ROS levels in UVB-irradiated HaCaT cells and UVA-irradiated HDF cells.

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 12 h) increased the migration rate of HaCaT cells.

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) mitigated MGO-induced AGE formation in HaCaT cells.

    LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003.  [Abstract]

    LL-37 (50 μM, 24 h) suppressed α-MSH-induced melanin production in HaCaT cells.

    LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) generated the redness and telangiectasis in the skin of BALB/c mice, with increased range of redness and the redness score.

    LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) elevated the levels of IL-6, TNF-α, IL-1α, and VEGF in BALB/c mice tissues.

    LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    The present study employed OCT to examine the structural characteristics of the skin of BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).

    LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    ELISA analysis of IL-17, CCL-3, CXCL-15 level in BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).

    LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636.  [Abstract]

    LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) caused a statistically significant increase in the presence of CD4+T cells and MCs within the dermis of BALB/c mice.
    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing[1][2][3].

    In Vitro

    LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration[2].
    LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].
    LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL[2].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Cell Migration Assay [2]

    Cell Line: Human corneal epithelial cell (HCEC)
    Concentration: 1, 2.5, 5, 10 and 20 μg/mL
    Incubation Time: 24 hours
    Result: Dose-dependently stimulated HCEC migration but showed no effect on cell proliferation.

    Cell Viability Assay[2]

    Cell Line: Human corneal epithelial cell (HCEC)
    Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
    Incubation Time: 6 and 24 hours
    Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
    In Vivo

    LL-37, human (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
    Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
    Administration: Intratracheal injection; 0.4-2.0 mg/kg once
    Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
    Molecular Weight

    4493.26

    Formula

    C205H340N60O53

    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

    Sequence Shortening

    [LL-37, 37 aa]

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Sealed storage, away from moisture and light, under nitrogen

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

    Solvent & Solubility
    In Vitro: 

    H2O : 50 mg/mL (11.13 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2226 mL 1.1128 mL 2.2256 mL
    5 mM 0.0445 mL 0.2226 mL 0.4451 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation

    Purity: 99.82%

    References

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2226 mL 1.1128 mL 2.2256 mL 5.5639 mL
    5 mM 0.0445 mL 0.2226 mL 0.4451 mL 1.1128 mL
    10 mM 0.0223 mL 0.1113 mL 0.2226 mL 0.5564 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    LL-37, human
    Cat. No.:
    HY-P1222
    Quantity:
    MCE Japan Authorized Agent: