LL-37, human
Based on 6 publication(s) in Google Scholar
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.
For research use only. We do not sell to patients.
- Purity: 99.82%
- CAS No.: 154947-66-7
- Formula: C205H340N60O53
- Molecular Weight:4493.26
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) LL-37, human
More
Customer Validation & Images
-
2D/3D Cell Culture and Differentiation
-
2D/3D Cell Culture and Differentiation
-
Cell Imaging/Staining
-
Cell Migration/Invasion Assay
-
ELISA
Biological Activity
|
Cell Line
|
Type | Value | Description | References |
|---|---|---|---|---|
| MRC5 | IC50 |
64 μM
Compound: LL-37
|
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
|
[PMID: 34342438] |
LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration[2]. LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2]. LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:Human corneal epithelial cell (HCEC)
-
Concentration:1, 2.5, 5, 10 and 20 μg/mL
-
Incubation Time:24 hours
-
Result:Dose-dependently stimulated HCEC migration but showed no effect on cell proliferation.
-
Cell Line:Human corneal epithelial cell (HCEC)
-
Concentration:0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
-
Incubation Time:6 and 24 hours
-
Result:Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
-
Dosage:0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
-
Administration:Intratracheal injection; 0.4-2.0 mg/kg once
-
Result:Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
Chemical Information
-
CAS No. 154947-66-7
-
Appearance Solid
-
Molecular Weight 4493.26
-
Formula C205H340N60O53
-
Color White to off-white
-
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
-
Sequence Shortening
[LL-37, 37 aa]
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (6)
-
Journal Impact Factor
-
Most Recent
-
Commun Biol
Vibrio cholerae senses human enteric α-defensin 5 through a CarSR two-component system to promote bacterial pathogenicity. [Abstract]2022 Jun 8;5(1):559. PMID: 35676416 -
Int Immunopharmacol
Oroxylin A suppress LL-37 generated rosacea-like skin inflammation through the modulation of SIRT3-SOD2-NF-κB signaling pathway. [Abstract]2024 Mar 10:129:111636. PMID: 38364746
LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636. [Abstract]
LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) generated the redness and telangiectasis in the skin of BALB/c mice, with increased range of redness and the redness score.
LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636. [Abstract]
LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) elevated the levels of IL-6, TNF-α, IL-1α, and VEGF in BALB/c mice tissues.
LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636. [Abstract]
The present study employed OCT to examine the structural characteristics of the skin of BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).
LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636. [Abstract]
ELISA analysis of IL-17, CCL-3, CXCL-15 level in BALB/c mice treated with LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d).
LL-37, human purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2024 Mar 10:129:111636. [Abstract]
LL-37, human TFA (320 μM; 40 μL; every 12 h for 2 d) caused a statistically significant increase in the presence of CD4+T cells and MCs within the dermis of BALB/c mice.
-
ACS Omega
Potential Antiphotoaging Effect of Human Cathelicidin LL-37 Fragments and KR-12 Analogs on UVB-Induced HaCaT Cells and UVA-Induced HDF Cells. [Abstract]2025 Aug 12;10(33):36994-37003. PMID: 40893218
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 24 h) showed no cytotoxicity to HaCaT and HDF cells.
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 24 h) demonstrated effective photodamage repair, increasing the survival of UVB-irradiated HaCaT cells by 14.6% and UVA-irradiated HDF cells by 11.8%.
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 24 h) reduced ROS levels in UVB-irradiated HaCaT cells and UVA-irradiated HDF cells.
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 12 h) increased the migration rate of HaCaT cells.
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 24 h) mitigated MGO-induced AGE formation in HaCaT cells.
LL-37, human purchased from MedChemExpress. Usage Cited in: ACS Omega. 2025 Aug 12;10(33):36994-37003. [Abstract]
LL-37 (50 μM, 24 h) suppressed α-MSH-induced melanin production in HaCaT cells.
-
FASEB J
Imperatorin Mitigates Rosacea-Like Inflammation by Modulating the Crosstalk Between JNK1 and STAT1. [Abstract]2026 Mar 15;40(5):e71641. PMID: 41773812 -
FASEB J
Integrated Multi-Omics and Experimental Validation Unveil the GZMK/NF-κB Axis Driving Inflammation and Fibroblast Proliferation in Rosacea: A Novel Drug Target Selection Strategy. [Abstract]2025 Oct 31;39(20):e71164. PMID: 41139274 -
Solvent & Solubility
H2O : 50 mg/mL (11.13 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (289 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Dürr UH, et al. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006 Sep;1758(9):1408-25. [Content Brief]
[2]. Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface. Invest Ophthalmol Vis Sci. 2006 Jun;47(6):2369-80. [Content Brief]
[3]. Hou M, et al. Antimicrobial peptide LL-37 and IDR-1 ameliorate MRSA pneumonia in vivo. Cell Physiol Biochem. 2013;32(3):614-23. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2226 mL | 1.1128 mL | 2.2256 mL | 5.5639 mL |
| 5 mM | 0.0445 mL | 0.2226 mL | 0.4451 mL | 1.1128 mL | |
| 10 mM | 0.0223 mL | 0.1113 mL | 0.2226 mL | 0.5564 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Powered by Bioz