1. Peptides
  2. LL-37, Human

LL-37, Human 

Cat. No.: HY-P1222
Handling Instructions

LL-37, Human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, Human Chemical Structure

LL-37, Human Chemical Structure

CAS No. : 154947-66-7

Size Price Stock
1 mg USD 260 Ask For Quote & Lead Time
5 mg USD 910 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Other In-stock Forms of LL-37, Human:

Other Forms of LL-37, Human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

LL-37, Human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity[1]. LL-37, Human could help protect the cornea from infection and modulates wound healing[2].

Molecular Weight

4493.26

Formula

C₂₀₅H₃₄₀N₆₀O₅₃

CAS No.

154947-66-7

Sequence

{Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser}

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LL-37, Human
Cat. No.:
HY-P1222
Quantity: