1. Anti-infection
  2. Bacterial
  3. pBD-1

pBD-1 

Cat. No.: HY-P2289
Handling Instructions

pBD-1 is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. pBD-1 has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

pBD-1 Chemical Structure

pBD-1 Chemical Structure

CAS No. : 206367-33-1

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of pBD-1:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

pBD-1 is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. pBD-1 has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs[1].

IC50 & Target

IC50: bacterial[1]

In Vitro

In a northern blot analysis, pBD-1 mRNA only expresses in ongue epithelial tissues from 4-5 week old pigs[1].
In RT-PCR analysis, pBD-1 message throughout the epithelia of the respiratory (from nasal septum to lung) and gastrointestinal (from esophagus to rectum) tracts. In addition, it is detected in thymus, spleen, lymph node, brain, liver, kidney, urinary bladder, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils and the umbilical cord. The only cells evaluated that does not express pBD-1 are peripheral blood mononuclear cells[1].

Molecular Weight

7065.98

Formula

C₃₁₀H₅₄₃N₉₁O₇₃S₁₁

CAS No.

206367-33-1

Sequence

{Met}{Arg}{Leu}{His}{Arg}{Leu}{Leu}{Leu}{Val}{Phe}{Leu}{Leu}{Met}{Val}{Leu}{Leu}{Pro}{Val}{Pro}{Gly}{Leu}{Leu}{Lys}{Asn}{Ile}{Gly}{Asn}{Ser}{Val}{Ser}{Cys}{Leu}{Arg}{Asn}{Lys}{Gly}{Val}{Cys}{Met}{Pro}{Gly}{Lys}{Cys}{Ala}{Pro}{Lys}{Met}{Lys}{Gln}{Ile}{Gly}{Thr}{Cys}{Gly}{Met}{Pro}{Gln}{Val}{Lys}{Cys}{Cys}{Lys}{Arg}{Lys}

Sequence Shortening

MRLHRLLLVFLLMVLLPVPGLLKNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

pBD-1pBD1pBD 1BacterialAntibioticporcinetissuesxenotransplantationmucosalsystemichostdefensebeta-defensinStaphylococcus aureusInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
pBD-1
Cat. No.:
HY-P2289
Quantity:
MCE Japan Authorized Agent: