country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P2289

Copy Link Print Information

β-defesin 1 (pig)

(Synonyms: pBD-1)

β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs.

For research use only. We do not sell to patients.

Formula: C₁₈₀H₃₁₃N₅₉O₅₀S₉
Molecular Weight:4392.36

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

β-defesin 1 (pig) Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- IC₅₀ & Target
- In Vitro
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

IC₅₀ & Target

IC50: bacterial^[1]

In Vitro

In a northern blot analysis, β-defesin 1 (pig) mRNA only expresses in ongue epithelial tissues from 4-5 week old pigs^[1].
In RT-PCR analysis, β-defesin 1 (pig) message throughout the epithelia of the respiratory (from nasal septum to lung) and gastrointestinal (from esophagus to rectum) tracts. In addition, it is detected in thymus, spleen, lymph node, brain, liver, kidney, urinary bladder, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils and the umbilical cord. The only cells evaluated that does not express β-defesin 1 (pig) are peripheral blood mononuclear cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

Molecular Weight 4392.36
Formula C₁₈₀H₃₁₃N₅₉O₅₀S₉
Synonyms

pBD-1
Sequence

Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
Sequence Shortening

NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (261 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Zhang G, et al. Molecular cloning and tissue expression of porcine beta-defensin-1.FEBS Lett. 1998 Mar 6;424(1-2):37-40. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock