Pediocin PA 1 TFA 

Pediocin PA-1 TFA is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA-1 TFA shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA-1 TFA can be used not only as a food biopreservative but also for research on listeriosis^[1][2][3].

Pediocin PA-1 (11.25-2900 nM; 24 h) TFA inhibits the growth of Listeria monocytogenes 10403S in 0.8% BHI soft agar with an MIC of 45 nM after 24 h incubation at 37 °C^[1].
Pediocin PA-1 (45-90.5 nM; up to 24 h) TFA exerts a bacteriostatic effect on Listeria monocytogenes 10403S in BHI broth at 37 °C, with 45-90.5 nM concentrations delaying exponential growth initiation by >8 hours over a 24 h period^[1].
Pediocin PA-1 (500 AU/mg of protein) TFA induces immediate efflux of pre-accumulated AIB and L-glutamate from sensitive P. pentosaceus PPE1.2 cells and prevents subsequent amino acid uptake^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4624.12 (free base)

C₁₉₆H₂₉₃N₆₁O₆₀S₅.xC₂HF₃O₂

Solid

White to off-white

Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

• [1]. Kuniyoshi TM, et al. An oxidation resistant pediocin PA-1 derivative and penocin A display effective anti-Listeria activity in a model human gut environment. Gut Microbes. 2022;14(1):2004071.  [Content Brief]

  [2]. Chikindas ML, et al. Pediocin PA-1, a bacteriocin from Pediococcus acidilactici PAC1.0, forms hydrophilic pores in the cytoplasmic membrane of target cells. Appl Environ Microbiol. 1993;59(11):3577-3584.  [Content Brief]

  [3]. Rodríguez JM, et al. Pediocin PA-1, a wide-spectrum bacteriocin from lactic acid bacteria. Crit Rev Food Sci Nutr. 2002;42(2):91-121.  [Content Brief]