Pediocin PA 1
Pediocin PA 1 is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA 1 shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA 1 can be used not only as a food biopreservative but also for research on listeriosis.
For research use only. We do not sell to patients.
- CAS No.: 111745-56-3
- Formula: C196H293N61O60S5
- Molecular Weight:4624.12
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Pediocin PA 1 (11.25-2900 nM; 24 h) inhibits the growth of Listeria monocytogenes 10403S in 0.8% BHI soft agar with an MIC of 45 nM after 24 h incubation at 37 °C[1].
Pediocin PA 1 (45-90.5 nM; up to 24 h) exerts a bacteriostatic effect on Listeria monocytogenes 10403S in BHI broth at 37 °C, with 45-90.5 nM concentrations delaying exponential growth initiation by >8 hours over a 24 h period[1].
Pediocin PA 1 (500 AU/mg of protein; immediate measurement post addition/unspecified time) induces immediate efflux of pre-accumulated AIB and L-glutamate from sensitive P. pentosaceus PPE1.2 cells and prevents subsequent amino acid uptake[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 111745-56-3
-
Molecular Weight 4624.12
-
Formula C196H293N61O60S5
-
Sequence
Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)
-
Sequence Shortening
KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Kuniyoshi TM, et al. An oxidation resistant pediocin PA-1 derivative and penocin A display effective anti-Listeria activity in a model human gut environment. Gut Microbes. 2022;14(1):2004071. [Content Brief]
[2]. Chikindas ML, et al. Pediocin PA-1, a bacteriocin from Pediococcus acidilactici PAC1.0, forms hydrophilic pores in the cytoplasmic membrane of target cells. Appl Environ Microbiol. 1993;59(11):3577-3584. [Content Brief]
[3]. Rodríguez JM, et al. Pediocin PA-1, a wide-spectrum bacteriocin from lactic acid bacteria. Crit Rev Food Sci Nutr. 2002 Mar;42(2):91-121. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pediocin PA 1 Related Classifications
HY-P10352 Related Classifications
Powered by Bioz
- Pediocin PA 1
- 111745-56-3
- Pediocin PA1
- Pediocin PA-1
- Bacterial
- cytoplasmic ATP
- Akkermansia muciniphila MucT
- Faecalibacterium prausnitzii A2-165
- cytoplasmic membrane protein
- Gram-negative bacteria
- Gram-positive bacteria
- transmembrane electrical potential
- Listeria monocytogenes
- proton motive force
- Eubacterium rectale A1-86
- Inhibitor
- inhibitor
- inhibit