1. Anti-infection
  2. Bacterial
  3. Pediocin PA 1

Pediocin PA 1 is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA 1 shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA 1 can be used not only as a food biopreservative but also for research on listeriosis.

It is advisable to consider the stable salt form (Pediocin PA 1 TFA) that retains the same biological activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pediocin PA 1

Pediocin PA 1 Chemical Structure

CAS No. : 111745-56-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Pediocin PA 1:

Other Forms of Pediocin PA 1:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pediocin PA 1 is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA 1 shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA 1 can be used not only as a food biopreservative but also for research on listeriosis[1][2][3].

In Vitro

Pediocin PA 1 (11.25-2900 nM; 24 h) inhibits the growth of Listeria monocytogenes 10403S in 0.8% BHI soft agar with an MIC of 45 nM after 24 h incubation at 37 °C[1].
Pediocin PA 1 (45-90.5 nM; up to 24 h) exerts a bacteriostatic effect on Listeria monocytogenes 10403S in BHI broth at 37 °C, with 45-90.5 nM concentrations delaying exponential growth initiation by >8 hours over a 24 h period[1].
Pediocin PA 1 (500 AU/mg of protein; immediate measurement post addition/unspecified time) induces immediate efflux of pre-accumulated AIB and L-glutamate from sensitive P. pentosaceus PPE1.2 cells and prevents subsequent amino acid uptake[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4624.12

Formula

C196H293N61O60S5

CAS No.
Sequence

Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

Sequence Shortening

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pediocin PA 1
Cat. No.:
HY-P10352
Quantity:
MCE Japan Authorized Agent: