1. Anti-infection
  2. Bacterial
  3. Pediocin PA 1 TFA

Pediocin PA-1 TFA is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA-1 TFA shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA-1 TFA can be used not only as a food biopreservative but also for research on listeriosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pediocin PA 1 TFA

Pediocin PA 1 TFA Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Pediocin PA 1 TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pediocin PA-1 TFA is a class IIa bacteriocin that specifically binds to membrane proteins of susceptible Gram-positive bacteria (such as Listeria monocytogenes) to form voltage-independent hydrophilic pores, leading to dissipation of proton motive force, ATP depletion and cell death. Pediocin PA-1 TFA shows no significant activity against intact Gram-negative bacteria, strains carrying immunity genes and obligate anaerobic commensal gut microbiota, and its bactericidal function depends on the integrity of disulfide bonds, with activity lost upon reduction. Pediocin PA-1 TFA can be used not only as a food biopreservative but also for research on listeriosis[1][2][3].

In Vitro

Pediocin PA-1 (11.25-2900 nM; 24 h) TFA inhibits the growth of Listeria monocytogenes 10403S in 0.8% BHI soft agar with an MIC of 45 nM after 24 h incubation at 37 °C[1].
Pediocin PA-1 (45-90.5 nM; up to 24 h) TFA exerts a bacteriostatic effect on Listeria monocytogenes 10403S in BHI broth at 37 °C, with 45-90.5 nM concentrations delaying exponential growth initiation by >8 hours over a 24 h period[1].
Pediocin PA-1 (500 AU/mg of protein) TFA induces immediate efflux of pre-accumulated AIB and L-glutamate from sensitive P. pentosaceus PPE1.2 cells and prevents subsequent amino acid uptake[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4624.12 (free base)

Formula

C196H293N61O60S5.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

Sequence Shortening

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : ≥ 100 mg/mL

*"≥" means soluble, but saturation unknown.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 95.24%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pediocin PA 1 TFA
Cat. No.:
HY-P10352A
Quantity:
MCE Japan Authorized Agent: