1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Phrixotoxin 3

Phrixotoxin 3 

Cat. No.: HY-P1218
Handling Instructions

Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current.

For research use only. We do not sell to patients.

Phrixotoxin 3 Chemical Structure

Phrixotoxin 3 Chemical Structure

CAS No. : 880886-00-0

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current[1].

IC50 & Target

Sodium Channels[1]

Molecular Weight

4059.72

Formula

C₁₇₆H₂₆₉N₅₁O₄₈S₆

CAS No.

880886-00-0

Sequence Shortening

DCLGFLWKCNSNDKCCRPNLVCSRKDKWCKYQI (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)

SMILES

[DCLGFLWKCNSNDKCCRPNLVCSRKDKWCKYQI (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Phrixotoxin 3Phrixotoxin3Phrixotoxin-3Sodium ChannelNa channelsNa+ channelsvoltage-gatedsodiumchannelsNaV1.1NaV1.2NaV1.3NaV1.4NaV1.5toxinsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Phrixotoxin 3
Cat. No.:
HY-P1218
Quantity:
MCE Japan Authorized Agent: