1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CXC Chemokine Receptor Chemokine Receptor
  5. CXCR7
  6. ACKR3 Protein, Human (His-SUMO)

ACKR3 is an atypical chemokine receptor that precisely controls chemokine levels and localization through high-affinity binding, operating independently of ligand-driven signaling. It acts as an interceptor, internalization receptor, and chemokine scavenger for CXCL11 and CXCL12/SDF1, inducing β-arrestin recruitment, ligand internalization, and MAPK pathway activation. ACKR3 Protein, Human (His-SUMO) is the recombinant human-derived ACKR3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACKR3 is an atypical chemokine receptor that precisely controls chemokine levels and localization through high-affinity binding, operating independently of ligand-driven signaling. It acts as an interceptor, internalization receptor, and chemokine scavenger for CXCL11 and CXCL12/SDF1, inducing β-arrestin recruitment, ligand internalization, and MAPK pathway activation. ACKR3 Protein, Human (His-SUMO) is the recombinant human-derived ACKR3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

ACKR3, an atypical chemokine receptor, exerts precise control over chemokine levels and localization through high-affinity chemokine binding, which operates independently of conventional ligand-driven signal transduction cascades. Functioning as an interceptor, internalizing receptor, chemokine-scavenging receptor, or chemokine decoy receptor, ACKR3 engages with chemokines such as CXCL11 and CXCL12/SDF1 without activating G-protein-mediated signal transduction. Instead, chemokine binding induces beta-arrestin recruitment, leading to ligand internalization and the activation of the MAPK signaling pathway. In migrating interneurons, ACKR3 is essential for regulating CXCR4 protein levels, adapting their responsiveness to chemokines. In glioma cells, ACKR3 transduces signals through the MEK/ERK pathway, conferring resistance to apoptosis and promoting cell growth and survival. While not influencing the migration, adhesion, or proliferation of normal hematopoietic progenitors, ACKR3, when activated by CXCL11 in malignant hematopoietic cells, enhances cell adhesion and migration through ERK1/2 phosphorylation. Additionally, ACKR3 plays a regulatory role in CXCR4-mediated activation of cell surface integrins and is vital for heart valve development. In the oculomotor system, ACKR3 regulates axon guidance by modulating CXCL12 levels. Furthermore, as a coreceptor with CXCR4, ACKR3 collaborates with a restricted number of HIV isolates during microbial infection.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P25106 (M1-K40)

Gene ID
Molecular Construction
N-term
6*His-SUMO
ACKR3 (M1-K40)
Accession # P25106
C-term
Protein Length

Extracellular Domain

Synonyms
RDC1; CXCR7; RDC-1; CMKOR1; CXC-R7; CXCR-7; GPR159;
AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH8.0 or PBS, pH 8.0, 6% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACKR3 Protein, Human (His-SUMO)
Cat. No.:
HY-P700537
Quantity:
MCE Japan Authorized Agent: