ACKR3 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

ACKR3 is an atypical chemokine receptor that precisely controls chemokine levels and localization through high-affinity binding, operating independently of ligand-driven signaling. It acts as an interceptor, internalization receptor, and chemokine scavenger for CXCL11 and CXCL12/SDF1, inducing β-arrestin recruitment, ligand internalization, and MAPK pathway activation. ACKR3 Protein, Human (His-SUMO) is the recombinant human-derived ACKR3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ACKR3 is an atypical chemokine receptor that precisely controls chemokine levels and localization through high-affinity binding, operating independently of ligand-driven signaling. It acts as an interceptor, internalization receptor, and chemokine scavenger for CXCL11 and CXCL12/SDF1, inducing β-arrestin recruitment, ligand internalization, and MAPK pathway activation. ACKR3 Protein, Human (His-SUMO) is the recombinant human-derived ACKR3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

ACKR3, an atypical chemokine receptor, exerts precise control over chemokine levels and localization through high-affinity chemokine binding, which operates independently of conventional ligand-driven signal transduction cascades. Functioning as an interceptor, internalizing receptor, chemokine-scavenging receptor, or chemokine decoy receptor, ACKR3 engages with chemokines such as CXCL11 and CXCL12/SDF1 without activating G-protein-mediated signal transduction. Instead, chemokine binding induces beta-arrestin recruitment, leading to ligand internalization and the activation of the MAPK signaling pathway. In migrating interneurons, ACKR3 is essential for regulating CXCR4 protein levels, adapting their responsiveness to chemokines. In glioma cells, ACKR3 transduces signals through the MEK/ERK pathway, conferring resistance to apoptosis and promoting cell growth and survival. While not influencing the migration, adhesion, or proliferation of normal hematopoietic progenitors, ACKR3, when activated by CXCL11 in malignant hematopoietic cells, enhances cell adhesion and migration through ERK1/2 phosphorylation. Additionally, ACKR3 plays a regulatory role in CXCR4-mediated activation of cell surface integrins and is vital for heart valve development. In the oculomotor system, ACKR3 regulates axon guidance by modulating CXCL12 levels. Furthermore, as a coreceptor with CXCR4, ACKR3 collaborates with a restricted number of HIV isolates during microbial infection.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • ACKR3 (M1-K40)
      Accession # P25106
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ACKR3; Chemokine (C-X-C Motif) Receptor 7; Prev. CMKOR1; G-Protein Coupled Receptor 159; Prev. CXCR7; CXC-R7; GPR159; CXCR-7; RDC1; RDC-1; Chemokine Orphan Receptor 1; G Protein-Coupled Receptor; G-Protein Coupled Receptor RDC1 Homolog; Atypical Chemokine

  • AA Sequence

    MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00