Animal-Free IL-23 p19 Protein, Human (His)

IL-23, collaborating with IL12B, constitutes the pro-inflammatory cytokine IL-23, crucial in innate and adaptive immunity. Released by antigen-presenting cells like dendritic cells or macrophages, IL-23 binds to IL12RB1 and IL23R, activating JAK2 and TYK2. This cascade phosphorylates STAT3 and STAT4, activating pathways like p38 MAPK or NF-kappa-B, inducing pro-inflammatory cytokines. IL-23 contributes to intracellular bacterial clearance and supports the expansion of T-helper 17 cells, including IL-17 producers. The disulfide-linked IL-23 interacts with IL12B and IL23R, recruiting IL12RB1. Animal-Free IL-23 p19 Protein, Human (His) is the recombinant human-derived animal-FreeIL-23 p19 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free IL-23 p19 Protein, Human (His) is 170 a.a., with molecular weight of ~19.49 kDa.

IL-23, in collaboration with IL12B, forms the pro-inflammatory cytokine IL-23, playing diverse roles in both innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, initiating a cascade involving JAK2 and TYK2 activation. These kinases phosphorylate the receptor, creating a docking site for the subsequent phosphorylation of STAT3 and STAT4. This process activates multiple pathways, including p38 MAPK or NF-kappa-B, fostering the production of pro-inflammatory cytokines, such as interleukin-17A/IL17A. Additionally, IL-23 actively participates in the early and effective clearance of intracellular bacteria. Notably, IL-23 promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, alongside other IL-17-producing cells. The heterodimeric association of IL-23 with IL12B, known as interleukin IL-23, is disulfide-linked. Furthermore, IL-23 interacts with IL23R, facilitating the recruitment of IL12RB1.

Measured by its ability to induce IL-17 secretion in mouse splenocytes. The ED₅₀ for this effect is <0.5 ng/mL.

Human

E. coli

N-His

Q9NPF7 (R20-P189)

51561  [NCBI]

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Approximately 19.49 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.