1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

Cat. No.: HY-P700168AF
Handling Instructions Technical Support

The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The IP-10/CRG-2/CXCL10 protein is a proinflammatory cytokine that regulates immune cells, cell growth, apoptosis, and vasostatic effects. It is critical during viral infection by binding to CXCR3 to activate immune cells and migrate them to the site of infection. Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Background

The IP-10/CRG-2/CXCL10 Protein is a pro-inflammatory cytokine that is involved in various processes such as chemotaxis, differentiation, and activation of immune cells, as well as the regulation of cell growth, apoptosis, and modulation of angiostatic effects. It plays a crucial role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, it binds to the CXCR3 receptor, which activates G protein-mediated signaling and leads to the activation of the phospholipase C-dependent pathway, increased intracellular calcium production, and actin reorganization. This activation of the CXCL10/CXCR3 axis is also important in neurons in response to brain injury, as it activates microglia and directs them to the site of injury, facilitating neuronal reorganization. The IP-10/CRG-2/CXCL10 Protein can exist as a monomer, dimer, or tetramer and interacts with the CXCR3 receptor.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P17515 (I22-P98)

Gene ID
Molecular Construction
N-term
6*His
CXCL10 (I22-P98)
Accession # P17515
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IP-10; Gamma-Interferon Inducible Protein 10; Crg-2
AA Sequence

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Predicted Molecular Mass
9.5 kDa
분자량

Approximately 7-11 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US;may vary elsewhere.

각종 서류

Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free IP-10/CRG-2/CXCL10 Protein, Mouse (His)
Cat. No.:
HY-P700168AF
수량:
MCE Japan Authorized Agent: