1. Recombinant Proteins
  2. Cathepsin D Protein, Mouse (HEK293, His)

Cathepsin D Protein, Mouse (HEK293, His)

Cat. No.: HY-P7749
Handling Instructions

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuCathepsin D, His; Cathepsin D; CTSD; CPSD
Species

Mouse

Source

HEK 293

Accession

P18242 (I21-L410)

Gene ID

13033

Molecular Weight

Approximately 56.0 kDa

AA Sequence

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.  

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM MES, 150 mM NaCl, pH5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Cathepsin D, a lysosomal aspartic protease, belongs to the pepsin family. Mouse Cathepsin D consists of a signal peptide (residues 120), a propeptide (residues 2164), and a mature chain (residues 65410) (13). Cathepsin D is expressed in most cells and overexpressed in in some cancer (breast, melanoma, ovary, etc.). Cathepsin D increases the incidence of clinical metastasis involves increased cell growth and decreased contact inhibition rather than escape of cancer cells through the basement membrane[1][2].
Cathepsin D acts as a protease following its activation at an acidic pH, or as a ligand of different membrane receptors at a more neutral pH[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin D Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7749
Quantity:
MCE Japan Authorized Agent: