Cathepsin D Protein, Mouse (HEK293, His)

Cathepsin D Protein, Mouse (HEK293, His) is an approximately 56.0 kDa mouse cathepsin D with a His tag. Cathepsin D is a lysosomal aspartic protease of the pepsin family^[1].

Cathepsin D, a lysosomal aspartic protease, belongs to the pepsin family. Mouse Cathepsin D consists of a signal peptide (residues 120), a propeptide (residues 2164), and a mature chain (residues 65410) (13). Cathepsin D is expressed in most cells and overexpressed in in some cancer (breast, melanoma, ovary, etc.). Cathepsin D increases the incidence of clinical metastasis involves increased cell growth and decreased contact inhibition rather than escape of cancer cells through the basement membrane^[1][2].
Cathepsin D acts as a protease following its activation at an acidic pH, or as a ligand of different membrane receptors at a more neutral pH^[1].

Measured by its ability to cleave a peptide substrate, Mca-PLGL-Dpa-AR-NH2. Read at excitation and emission wavelengths of 320 nm and 405 nm (top read). The specific activity is 5026.88 pmol/min/µg, as measured under the described conditions.

Mouse

HEK293

C-6*His

P18242 (I21-L410)

13033  [NCBI]

Full Length of Mature Protein

IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

Approximately 46 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. H Rochefort, et al.Cathepsin D in breast cancer: mechanisms and clinical applications, a 1999 overview. Clin Chim Acta. 2000 Feb 15;291(2):157-70.  [Content Brief]

  [2]. T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells  [Content Brief]