CCL4 Protein, Rat
Based on 1 Customer Validation
CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.
CCL4, a monokine, exhibits inflammatory and chemokinetic properties as it functions as a homodimer.
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 14.43 ng/mL, corresponding to a specific activity is 6.930×104 U/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P50230 (A24-N92)
-
Molecular Construction
-
N-term
-
CCL4 (A24-N92)
Accession # P50230 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL4; Act-2; Prev. SCYA4; MIP1B; Prev. LAG1; HC21; MIP-1-Beta; Monocyte Adherence-Induced Protein 5 Alpha; AT744.1; Chemokine C-C Motif Ligand 4; Small Inducible Cytokine A4 (Homologous To Mouse Mip-1b); Small-Inducible Cytokine A4; Macrophage Inflammator
-
AA Sequence
APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
