CCL4 Protein, Rat

CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free. The total length of CCL4 Protein, Rat is 69 a.a., with molecular weight of ~11 kDa.

CCL4, a monokine, exhibits inflammatory and chemokinetic properties as it functions as a homodimer.

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED₅₀ for this effect is 14.43 ng/mL, corresponding to a specific activity is 6.930×10⁴ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5.The ED₅₀ for this effect is 14.43 ng/mL, corresponding to a specific activity is 6.930×10⁴ U/mg.

Rat

E. coli

Tag Free

P50230 (A24-N92)

116637  [NCBI]

APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.