CCR2 Protein, Mouse (N-His, C-Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

CCR2, a pivotal protein, serves as a key functional receptor for chemokines such as CCL2, CCL7, and CCL12. Its engagement with CCL2 on monocytes and macrophages orchestrates chemotaxis and migration induction through the activation of the PI3K cascade, involving the small G protein Rac and lamellipodium protrusion. Beyond its role in chemokine signaling, CCR2 acts as a receptor for the beta-defensin DEFB106A/DEFB106B. This versatile receptor plays a crucial role in regulating T-cell inflammatory cytokines and T-cell differentiation, promoting the generation of T-helper 17 cells (Th17) during inflammation. Additionally, CCR2 is implicated in facilitating the export of mature thymocytes, enhancing directional movement in response to sphingosine-1-phosphate stimulation, and up-regulating S1P1R expression through JAK-STAT signaling. Moreover, CCR2's involvement in neuropathic pain, synaptic transmission modulation, and the recruitment of macrophages and monocytes to injury sites underscores its multifaceted impact in diverse physiological contexts. Interactions with proteins like ARRB1 and DEFB106A/DEFB106B further contribute to the intricate regulatory network orchestrated by CCR2.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • CCR2 (M1-A55)
      Accession # P51683
    • Myc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CCR2; CCR-2; Prev. CMKBR2; Chemokine Receptor 2; CC-CKR-2; MCP-1 Receptor; MCP-1-R; CD192 Antigen; C-C Chemokine Receptor Type 2; C-C CKR-2; CD192; CCR2A; CKR2; CCR2B; Monocyte Chemoattractant Protein 1 Receptor; CKR2A; Chemokine (C-C Motif) Receptor 2; C

  • AA Sequence

    MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

  • Predicted Molecular Mass

    13.6 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00