CCR2 Protein, Mouse (N-His, C-Myc)

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of CCR2 Protein, Mouse (N-His, C-Myc) is 55 a.a., with molecular weight of 13.6 kDa.

CCR2, a pivotal protein, serves as a key functional receptor for chemokines such as CCL2, CCL7, and CCL12. Its engagement with CCL2 on monocytes and macrophages orchestrates chemotaxis and migration induction through the activation of the PI3K cascade, involving the small G protein Rac and lamellipodium protrusion. Beyond its role in chemokine signaling, CCR2 acts as a receptor for the beta-defensin DEFB106A/DEFB106B. This versatile receptor plays a crucial role in regulating T-cell inflammatory cytokines and T-cell differentiation, promoting the generation of T-helper 17 cells (Th17) during inflammation. Additionally, CCR2 is implicated in facilitating the export of mature thymocytes, enhancing directional movement in response to sphingosine-1-phosphate stimulation, and up-regulating S1P1R expression through JAK-STAT signaling. Moreover, CCR2's involvement in neuropathic pain, synaptic transmission modulation, and the recruitment of macrophages and monocytes to injury sites underscores its multifaceted impact in diverse physiological contexts. Interactions with proteins like ARRB1 and DEFB106A/DEFB106B further contribute to the intricate regulatory network orchestrated by CCR2.

Mouse

E. coli

C-Myc;N-10*His

P51683 (M1-A55)

12772  [NCBI]

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

13.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.