CCR2 Protein, Mouse (N-His, C-Myc)
Based on 1 publication(s) in Google Scholar
CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Background
CCR2, a pivotal protein, serves as a key functional receptor for chemokines such as CCL2, CCL7, and CCL12. Its engagement with CCL2 on monocytes and macrophages orchestrates chemotaxis and migration induction through the activation of the PI3K cascade, involving the small G protein Rac and lamellipodium protrusion. Beyond its role in chemokine signaling, CCR2 acts as a receptor for the beta-defensin DEFB106A/DEFB106B. This versatile receptor plays a crucial role in regulating T-cell inflammatory cytokines and T-cell differentiation, promoting the generation of T-helper 17 cells (Th17) during inflammation. Additionally, CCR2 is implicated in facilitating the export of mature thymocytes, enhancing directional movement in response to sphingosine-1-phosphate stimulation, and up-regulating S1P1R expression through JAK-STAT signaling. Moreover, CCR2's involvement in neuropathic pain, synaptic transmission modulation, and the recruitment of macrophages and monocytes to injury sites underscores its multifaceted impact in diverse physiological contexts. Interactions with proteins like ARRB1 and DEFB106A/DEFB106B further contribute to the intricate regulatory network orchestrated by CCR2.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Free Radic Biol Med
Ultrasound-responsive taurine lipid nanoparticles attenuate oxidative stress and promote macrophage polarization for diabetic wound healing. [Abstract]2025 Apr 3:S0891-5849(25)00207-2. PMID: 40187503
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-Myc;N-10*His
-
Accession
P51683 (M1-A55)
-
Molecular Construction
-
N-term
-
10*His
-
CCR2 (M1-A55)
Accession # P51683 -
Myc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CCR2; CCR-2; Prev. CMKBR2; Chemokine Receptor 2; CC-CKR-2; MCP-1 Receptor; MCP-1-R; CD192 Antigen; C-C Chemokine Receptor Type 2; C-C CKR-2; CD192; CCR2A; CKR2; CCR2B; Monocyte Chemoattractant Protein 1 Receptor; CKR2A; Chemokine (C-C Motif) Receptor 2; C
-
AA Sequence
MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH8.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)