CD36 Protein, Human (HEK293, Fc )

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, Fc ) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, Fc ) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD36 is a versatile glycoprotein serving as a receptor for a diverse array of ligands, encompassing proteinaceous entities like thrombospondin, fibronectin, collagen, or amyloid-beta, as well as lipidic components such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids, and bacterial diacylated lipopeptides. Exhibiting multivalency, these ligands can engage multiple receptors simultaneously, prompting the formation of CD36 clusters that initiate signal transduction and the internalization of receptor-ligand complexes. The dependency on coreceptor signaling is notably ligand specific. Cellular responses to these ligands play pivotal roles in angiogenesis, inflammatory responses, fatty acid metabolism, taste, and dietary fat processing in the intestine. Additionally, CD36 binds long-chain fatty acids, facilitating their transport into cells and participating in muscle lipid utilization, adipose energy storage, and gut fat absorption. Mechanistically, fatty acid binding activates downstream kinase LYN, phosphorylating palmitoyltransferase ZDHHC5 and leading to CD36 depalmitoylation and caveolar endocytosis. In the small intestine, CD36 plays a role in the proximal absorption of dietary fatty acids and cholesterol, potentially through the activation of the MAPK1/3 (ERK1/2) signaling pathway. It is also involved in oral fat perception and preferences, mediating intracellular calcium level increases in taste receptor cells. Furthermore, CD36 is a significant factor in ventromedial hypothalamus neuronal sensing of long-chain fatty acids and the regulation of energy and glucose homeostasis. Acting as a receptor for thrombospondins, CD36 mediates their antiangiogenic effects and induces apoptosis in podocytes in response to elevated free fatty acids, in collaboration with THBS1. As a coreceptor for TLR4:TLR6 heterodimer, CD36 promotes inflammation in monocytes/macrophages upon ligand binding, leading to NF-kappa-B-dependent cytokine production and IL1B secretion through the priming and activation of the NLRP3 inflammasome. Furthermore, CD36 serves as a selective and nonredundant sensor of microbial diacylated lipopeptides, triggering NF-kappa-B-dependent TNF production and subsequent Golgi targeting in a lipid-raft dependent pathway through TLR2:TLR6 heterodimer signaling. In the context of microbial infection, CD36 directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD36 is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human TSP-2. The ED50 for this effect is 53.53 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human CD36 is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human TSP-2. The ED50 for this effect is 53.53 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD36 (G30-N439)
      Accession # P16671
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD36; Leukocyte Differentiation Antigen CD36; CD36 Molecule (CD36 Blood Group); Thrombospondin Receptor; Platelet Glycoprotein 4; CD36 Antigen; GPIIIB; PAS-4; GPIV; CD36 Molecule (CD36 Blood Group) Transcript; GP3B; Scavenger Receptor Class B, Member 3; F

  • AA Sequence

    GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

  • Molecular Weight

    Approximately 90-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00