1. Recombinant Proteins
  2. Others
  3. CDK2AP2 Protein, Human (HEK293, His)

The CDK2AP2 protein is an important component of the NuRD complex and actively participates in chromatin remodeling. It inhibits the G1/S phase transition by inhibiting CDK2 and preventing the interaction of CDK2 with cyclin E or A. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CDK2AP2 protein is an important component of the NuRD complex and actively participates in chromatin remodeling. It inhibits the G1/S phase transition by inhibiting CDK2 and preventing the interaction of CDK2 with cyclin E or A. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CDK2AP2 protein functions as a key component of the histone deacetylase NuRD complex, actively participating in chromatin remodeling. Its regulatory role extends to inhibiting the G1/S phase transition in the cell cycle by suppressing CDK2 expression and activation, achieved through interference with the interaction between CDK2 and cyclin E or A. Beyond cell cycle control, CDK2AP2 plays a crucial role in the self-renewal of embryonic stem cells (ESCs) and ensures cell survival during the terminal differentiation of ESCs. Additionally, it contributes to the regulation of microtubule organization in metaphase II oocytes. As part of the NuRD repressor complex, CDK2AP2 collaborates with various core and peripherally associated proteins, including MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, CDK2AP1, GATAD2A, GATAD2B, CHD3, CHD4, and CHD5. Interactions with CDK2AP1, CDK2, and MAPK1 further underline its multifaceted regulatory functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O75956 (M1-T126)

Gene ID
Molecular Construction
N-term
CDK2AP2 (M1-T126)
Accession # O75956
6*His
C-term
Protein Length

Full Length

Synonyms
rHuCyclin-dependent kinase 2-associated protein 2/CDK2AP2, His; Cyclin-dependent kinase 2-associated protein 2; CDK2-associated protein 2; DOC-1-related protein; DOC-1R; CDK2AP2; DOC1R
AA Sequence

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

Predicted Molecular Mass
14.1 kDa
Molecular Weight

Approximately 26 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CDK2AP2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CDK2AP2 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK2AP2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7850
Quantity:
MCE Japan Authorized Agent: