CDK2AP2 Protein, Human (HEK293, His)
The CDK2AP2 protein is an important component of the NuRD complex and actively participates in chromatin remodeling. It inhibits the G1/S phase transition by inhibiting CDK2 and preventing the interaction of CDK2 with cyclin E or A. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CDK2AP2 protein is an important component of the NuRD complex and actively participates in chromatin remodeling. It inhibits the G1/S phase transition by inhibiting CDK2 and preventing the interaction of CDK2 with cyclin E or A. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293 , with C-6*His labeled tag.
CDK2AP2 protein functions as a key component of the histone deacetylase NuRD complex, actively participating in chromatin remodeling. Its regulatory role extends to inhibiting the G1/S phase transition in the cell cycle by suppressing CDK2 expression and activation, achieved through interference with the interaction between CDK2 and cyclin E or A. Beyond cell cycle control, CDK2AP2 plays a crucial role in the self-renewal of embryonic stem cells (ESCs) and ensures cell survival during the terminal differentiation of ESCs. Additionally, it contributes to the regulation of microtubule organization in metaphase II oocytes. As part of the NuRD repressor complex, CDK2AP2 collaborates with various core and peripherally associated proteins, including MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, CDK2AP1, GATAD2A, GATAD2B, CHD3, CHD4, and CHD5. Interactions with CDK2AP1, CDK2, and MAPK1 further underline its multifaceted regulatory functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O75956 (M1-T126)
-
Molecular Construction
-
N-term
-
CDK2AP2 (M1-T126)
Accession # O75956 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CDK2AP2; Tumor Suppressor Deleted In Oral Cancer Related 1; Cyclin Dependent Kinase 2 Associated Protein 2; Cyclin-Dependent Kinase 2-Associated Protein 2; DOC-1R; DOC-1-Related Protein; CDK2-Associated Protein 2; DOC1R; P14; Cyclin-Dependent Kinase 2-Ass
-
AA Sequence
MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
-
Predicted Molecular Mass
14.1 kDa
-
Molecular Weight
Approximately 55 kDa & 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
