1. Recombinant Proteins
  2. Others
  3. CDK2AP2 Protein, Human (HEK293, His)

CDK2AP2 Protein, Human (HEK293, His)

Cat. No.: HY-P7850
Handling Instructions

CDK2AP2 protein, a vital component of the NuRD complex, actively engages in chromatin remodeling. It inhibits G1/S phase transition by suppressing CDK2, impeding CDK2's interaction with cyclin E or A. Beyond cell cycle control, CDK2AP2 is crucial for ESC self-renewal, ensuring survival during differentiation, and regulates microtubule organization in metaphase II oocytes. Part of the NuRD complex, CDK2AP2 collaborates with proteins like MTA1, MTA2, HDAC1, and others, showcasing its multifaceted regulatory functions. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CDK2AP2 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of ~26.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDK2AP2 protein, a vital component of the NuRD complex, actively engages in chromatin remodeling. It inhibits G1/S phase transition by suppressing CDK2, impeding CDK2's interaction with cyclin E or A. Beyond cell cycle control, CDK2AP2 is crucial for ESC self-renewal, ensuring survival during differentiation, and regulates microtubule organization in metaphase II oocytes. Part of the NuRD complex, CDK2AP2 collaborates with proteins like MTA1, MTA2, HDAC1, and others, showcasing its multifaceted regulatory functions. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CDK2AP2 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of ~26.0 kDa.

Background

CDK2AP2 protein functions as a key component of the histone deacetylase NuRD complex, actively participating in chromatin remodeling. Its regulatory role extends to inhibiting the G1/S phase transition in the cell cycle by suppressing CDK2 expression and activation, achieved through interference with the interaction between CDK2 and cyclin E or A. Beyond cell cycle control, CDK2AP2 plays a crucial role in the self-renewal of embryonic stem cells (ESCs) and ensures cell survival during the terminal differentiation of ESCs. Additionally, it contributes to the regulation of microtubule organization in metaphase II oocytes. As part of the NuRD repressor complex, CDK2AP2 collaborates with various core and peripherally associated proteins, including MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, CDK2AP1, GATAD2A, GATAD2B, CHD3, CHD4, and CHD5. Interactions with CDK2AP1, CDK2, and MAPK1 further underline its multifaceted regulatory functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O75956 (M1-T126)

Gene ID
Molecular Construction
N-term
CDK2AP2 (M1-T126)
Accession # O75956
6*His
C-term
Synonyms
rHuCyclin-dependent kinase 2-associated protein 2/CDK2AP2, His; Cyclin-dependent kinase 2-associated protein 2; CDK2-associated protein 2; DOC-1-related protein; DOC-1R; CDK2AP2; DOC1R
AA Sequence

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

Molecular Weight

Approximately 26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CDK2AP2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDK2AP2 Protein, Human (HEK293, His)
Cat. No.:
HY-P7850
Quantity:
MCE Japan Authorized Agent: