Langerin/CD207 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
CLC4K protein, a calcium-dependent lectin encoded by CD207, belongs to the C-type lectin domain family. CLC4K has mannose-binding specificity and is involved in antigen presentation to T cells. CLC4K is the major receptor for Candida, Saccharomyces, and Malassezia furfur on primary Langerhans cells. Langerhans cells are specialized antigen-presenting cells located within the epithelium of the epidermis and mucosa. Upon contact with Langerhans cells, pathogens are captured by the C-type lectin langerin and internalized into structurally unique vesicles called Birbeck granules (BGs). CLC4K induces the formation of Birbeck granules and protects against human immunodeficiency virus 1 (HIV-1) infection. Molecular mechanisms for membrane zipping exist during Birbeck granule biogenesis, and CLC4K is a potent regulator of membrane stacking and zipping. CLC4K binds to high-mannose structures present on the envelope glycoprotein and subsequently targets the virus to Birbeck particles, causing their rapid degradation. Langerhans cell histiocytosis (LCH) is a disorder characterized by clonal expansion of myeloid precursor cells that differentiate into CD1a1/CD207 cells within the lesion. Therefore, detection of clonal tumor proliferation with expression of CD1a, CD207 (Langerin), and S100 can help diagnose LCH.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
AAH22278.1 (Y64-P328)
-
Molecular Construction
-
N-term
-
6*His
-
Langerin (Y64-P328)
Accession # AAH22278.1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD207; Langerhans Cell Specific C-Type Lectin; CD207 Molecule; CD207 Molecule, Langerin; CLEC4K; CD207 Antigen, Langerin; C-Type Lectin Domain Family 4 Member K; C-Type Lectin Domain Family 4, Member K; Langerin; CD207 Antigen
-
AA Sequence
YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
-
Predicted Molecular Mass
31.5 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)