Langerin/CD207 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CLC4K protein, a calcium-dependent lectin, promotes antigen uptake. CLC4K is able to bind to sulfated as well as mannosylated glycans, keratan sulfate (KS), and β-glucan. Langerin/CD207 Protein, Human (HEK293, His) is the recombinant human-derived Langerin/CD207 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

CLC4K protein, a calcium-dependent lectin encoded by CD207, belongs to the C-type lectin domain family. CLC4K has mannose-binding specificity and is involved in antigen presentation to T cells. CLC4K is the major receptor for Candida, Saccharomyces, and Malassezia furfur on primary Langerhans cells. Langerhans cells are specialized antigen-presenting cells located within the epithelium of the epidermis and mucosa. Upon contact with Langerhans cells, pathogens are captured by the C-type lectin langerin and internalized into structurally unique vesicles called Birbeck granules (BGs). CLC4K induces the formation of Birbeck granules and protects against human immunodeficiency virus 1 (HIV-1) infection. Molecular mechanisms for membrane zipping exist during Birbeck granule biogenesis, and CLC4K is a potent regulator of membrane stacking and zipping. CLC4K binds to high-mannose structures present on the envelope glycoprotein and subsequently targets the virus to Birbeck particles, causing their rapid degradation. Langerhans cell histiocytosis (LCH) is a disorder characterized by clonal expansion of myeloid precursor cells that differentiate into CD1a1/CD207 cells within the lesion. Therefore, detection of clonal tumor proliferation with expression of CD1a, CD207 (Langerin), and S100 can help diagnose LCH.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Langerin (Y64-P328)
      Accession # AAH22278.1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD207; Langerhans Cell Specific C-Type Lectin; CD207 Molecule; CD207 Molecule, Langerin; CLEC4K; CD207 Antigen, Langerin; C-Type Lectin Domain Family 4 Member K; C-Type Lectin Domain Family 4, Member K; Langerin; CD207 Antigen

  • AA Sequence

    YPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

  • Predicted Molecular Mass

    31.5 kDa

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00