1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF R
  5. CSF1R Protein, Mouse (HEK293, His)

CSF1R Protein, Mouse (HEK293, His)

Cat. No.: HY-P72952
COA Handling Instructions

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag. The total length of CSF1R Protein, Mouse (HEK293, His) is 492 a.a., with molecular weight (glycosylation form) of ~80-90 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
500 μg $850 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag. The total length of CSF1R Protein, Mouse (HEK293, His) is 492 a.a., with molecular weight (glycosylation form) of ~80-90 kDa.

Background

CSF1R protein, a tyrosine-protein kinase, serves as a cell-surface receptor for CSF1 and IL34, exerting pivotal control over the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. Its role in innate immunity and inflammatory processes is underscored by its promotion of the release of pro-inflammatory chemokines in response to IL34 and CSF1. Additionally, CSF1R plays a critical role in the regulation of osteoclast proliferation and differentiation, bone resorption, and is indispensable for normal bone and tooth development. It is essential for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy. Notably, CSF1R influences the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, cell migration, and facilitates cancer cell invasion. Upon ligand binding, CSF1R activates multiple signaling pathways, including ERK1/2, JNK, PI3K/AKT, MAP kinases (MAPK1/ERK2 and/or MAPK3/ERK1), and SRC family kinases (SRC, FYN, YES1). Its downstream effects involve the phosphorylation of various target proteins, such as PIK3R1, PLCG2, GRB2, SLA2, and CBL. Furthermore, CSF1R mediates the activation of STAT family members (STAT3, STAT5A, and/or STAT5B) and promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. The receptor signaling is tightly regulated by protein phosphatases, including INPP5D/SHIP-1, and by the rapid internalization of the activated receptor. In the central nervous system, CSF1R may contribute to the development of microglia macrophages.

Biological Activity

Measured by its ability to inhibit the M-CSF-induced proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.4080 µg/mL in the presence of 10 ng/mL mouse M-CSF. Corresponding to a specific activity is 2.451×103 units/mg.

  • Measured by its ability to inhibit the M-CSF-induced proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.4080 µg/mL in the presence of 10 ng/mL mouse M-CSF, corresponding to a specific activity is 2.451×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

P09581 (A20-S511)

Gene ID
Molecular Construction
N-term
CSF1R (A20-S511)
Accession # P09581
His
C-term
Synonyms
Macrophage colony-stimulating factor 1 receptor; CSF-1R; M-CSF-R; CD115; CSF1R; FMS
AA Sequence

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Weight

Approximately 80-90 kDa, due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CSF1R Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSF1R Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72952
Quantity:
MCE Japan Authorized Agent: