CSF1R Protein, Mouse (HEK293, His)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, His) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

CSF1R protein, a tyrosine-protein kinase, serves as a cell-surface receptor for CSF1 and IL34, exerting pivotal control over the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. Its role in innate immunity and inflammatory processes is underscored by its promotion of the release of pro-inflammatory chemokines in response to IL34 and CSF1. Additionally, CSF1R plays a critical role in the regulation of osteoclast proliferation and differentiation, bone resorption, and is indispensable for normal bone and tooth development. It is essential for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy. Notably, CSF1R influences the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, cell migration, and facilitates cancer cell invasion. Upon ligand binding, CSF1R activates multiple signaling pathways, including ERK1/2, JNK, PI3K/AKT, MAP kinases (MAPK1/ERK2 and/or MAPK3/ERK1), and SRC family kinases (SRC, FYN, YES1). Its downstream effects involve the phosphorylation of various target proteins, such as PIK3R1, PLCG2, GRB2, SLA2, and CBL. Furthermore, CSF1R mediates the activation of STAT family members (STAT3, STAT5A, and/or STAT5B) and promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. The receptor signaling is tightly regulated by protein phosphatases, including INPP5D/SHIP-1, and by the rapid internalization of the activated receptor. In the central nervous system, CSF1R may contribute to the development of microglia macrophages.

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit the M-CSF-induced proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 0.2-0.8 µg/mL in the presence of 10 ng/mL mouse M-CSF.
3.Immobilized Mouse M-CSF at 2 μg/mL (100 μL/well) can bind Mouse CSF1R, The ED50 for this effect is 0.589 μg/ml.

• 
  Measured by its ability to inhibit the M-CSF-induced proliferation of M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 0.4080 µg/mL in the presence of 10 ng/mL mouse M-CSF, corresponding to a specific activity is 2.451×10³ units/mg.

Mouse

HEK293

C-His

P09581/NP_001032948.2 (A20-S511)

12978  [NCBI]

Extracellular Domain

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Approximately 75-100 kDa due to glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.