1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Dectin-1
  6. Dectin-1/CLEC7A Protein, Human (HEK293, Fc)

Dectin-1/CLEC7A Protein, Human (HEK293, Fc)

Cat. No.: HY-P70101
COA Handling Instructions

The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is 182 a.a., with molecular weight of 50-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $90 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Dectin-1/CLEC7A Protein, Human (HEK293, Fc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is 182 a.a., with molecular weight of 50-65 kDa.

Background

Dectin-1/CLEC7A Protein operates as a lectin, functioning as a pattern recognition receptor (PRR) specifically designed for beta-1,3-linked and beta-1,6-linked glucans, prominent constituents of cell walls in pathogenic bacteria and fungi. Essential for the Toll-like receptor 2 (TLR2)-mediated inflammatory response, Dectin-1, upon binding to beta-glucan, recruits spleen tyrosine kinase (SYK) via its immunoreceptor tyrosine-based activation motif (ITAM) and instigates a signaling cascade. This cascade activates CARD domain-BCL10-MALT1 (CBM) signalosomes, leading to the activation of NF-kappa-B and MAP kinase p38 pathways. Consequently, the stimulation of gene expression encoding pro-inflammatory cytokines and chemokines ensues, thereby enhancing cytokine production in macrophages and dendritic cells. Beyond its role in inflammation, Dectin-1 mediates the production of reactive oxygen species and is instrumental in the phagocytosis of Candida albicans conidia. Moreover, Dectin-1 binds T-cells, playing a role in T-cell activation, inducing phosphorylation of SCIMP upon beta-glucan binding. Existing as a homodimer, Dectin-1 interacts with SYK, participating in leukocyte activation in the presence of fungal pathogens.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9BXN2 (T66-M247)

Gene ID
Molecular Construction
N-term
hFc
CLEC7A (T66-M247)
Accession # Q9BXN2
C-term
Synonyms
rHuC-type lectin domain family 7 member A/Dectin-1, Fc; Beta-glucan receptor; BGR; CD369; CLEC7A; CLECSF12; CLECSF12DC-associated C-type lectin 1; Dectin1; Dectin-1; DECTIN1CANDF4
AA Sequence

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

Molecular Weight

50-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Dectin-1/CLEC7A Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Dectin-1/CLEC7A Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70101
Quantity:
MCE Japan Authorized Agent: