EphA2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The EphA2 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Activated by the ligand ephrin-A1/EFNA1, EphA2 plays a regulatory role in cell migration, integrin-mediated adhesion, proliferation, and differentiation. Additionally, EphA2 modulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibits the ERK1/ERK2 signaling pathway. It may also participate in UV radiation-induced apoptosis and exhibit a ligand-independent stimulatory effect on chemotactic cell migration. During development, EphA2 functions in various aspects of pattern formation and contributes to the development of several fetal tissues, including angiogenesis, early hindbrain development, and epithelial proliferation and branching morphogenesis during mammary gland development. Interaction with the ligand ephrin-A5/EFNA5 may regulate lens fiber cells' shape and interactions, playing a crucial role in lens transparency development and maintenance. Furthermore, in collaboration with ephrin-A2/EFNA2, EphA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized mouse EphA2 at 2 μg/mL (100 μl/well) can bind mouse EphrinA1 with a linear range of 0.16-20 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EphA2 (K26-N535)
      Accession # Q03145
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    EPHA2; Protein Tyrosine Kinase; Prev. ECK; CTRCT6; Tyrosine-Protein Kinase Receptor ECK; EphA2; Ephrin Type-A Receptor 2; ARCC2; Epithelial Cell Receptor Protein Tyrosine Kinase; CTPP1; Receptor Protein-Tyrosine Kinase; CTPA; EPH Receptor A2; Epithelial C

  • AA Sequence

    KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSAN

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00