1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Eph Receptors
  5. EphA2
  6. EphA2 Protein, Mouse (HEK293, His)

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The EphA2 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Activated by the ligand ephrin-A1/EFNA1, EphA2 plays a regulatory role in cell migration, integrin-mediated adhesion, proliferation, and differentiation. Additionally, EphA2 modulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibits the ERK1/ERK2 signaling pathway. It may also participate in UV radiation-induced apoptosis and exhibit a ligand-independent stimulatory effect on chemotactic cell migration. During development, EphA2 functions in various aspects of pattern formation and contributes to the development of several fetal tissues, including angiogenesis, early hindbrain development, and epithelial proliferation and branching morphogenesis during mammary gland development. Interaction with the ligand ephrin-A5/EFNA5 may regulate lens fiber cells' shape and interactions, playing a crucial role in lens transparency development and maintenance. Furthermore, in collaboration with ephrin-A2/EFNA2, EphA2 may contribute to bone remodeling by regulating osteoclastogenesis and osteoblastogenesis.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized mouse EphA2 at 2 μg/mL (100 μl/well) can bind mouse EphrinA1 with a linear range of 0.16-20 ng/mL.

  • Immobilized Recombinant Mouse EphA2 Proteinat 2 μg/mL (100 μL/well) can bind Recombinant Mouse Ephrin-A1 / EFNA1 Protein, the ED50 is 11.4 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q03145 (K26-N535)

Gene ID
Molecular Construction
N-term
EphA2 (K26-N535)
Accession # Q03145
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ephrin type-A receptor 2; Epithelial cell kinase; EPHA2; ECK
AA Sequence

KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSAN

Molecular Weight

Approximately 65-95 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5%Trehalose, 5% Mannitol, 0.01%Tween-80, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphA2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75240
Quantity:
MCE Japan Authorized Agent: