Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc)

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-hFc labeled tag.

Ephrin-A3 (EFNA3) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that plays a pivotal role in cellular interactions during development. It belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for processes such as migration, repulsion, and adhesion in neuronal, vascular, and epithelial tissues. EFNA3 exhibits promiscuous binding to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This bidirectional signaling involves the forward signaling pathway downstream of the receptor and the reverse signaling pathway downstream of the ephrin ligand. Furthermore, EFNA3 specifically interacts with EPHA8, activating the receptor and contributing to downstream signaling events.

Immobilized mouse EphA6 at 2μg/ml (100 μl/well) can bind human EphrinA3 / Fc Chimera. The EC₅₀ of human EphrinA3 is 302.9ng/mL.

Human

HEK293

C-hFc

P52797-1 (Q23-S213)

1944  [NCBI]

Partial

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Approximately 60-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.