Copy Link Print Information

Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)
  • Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-A3/EFNA3 Protein is a cell surface GPI-bound ligand that plays a critical role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases involved in migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling. The receptor's downstream signaling is known as forward signaling, while the ephrin ligand's downstream signaling is referred to as reverse signaling. Ephrin-A3/EFNA3 also interacts with EPHA8 and activates this receptor, further contributing to its regulatory functions.

Verified Bioactivity

Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    O08545 (Q23-S205)

  • Gene ID
    13638  [NCBI]
  • Molecular Construction
    • N-term
    • EFNA3 (Q23-S205)
      Accession # O08545
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    EFNA3; EHK1 Ligand; Prev. EPLG3; EFL-2; LERK3; EFL2; EPH-Related Receptor Tyrosine Kinase Ligand 3; Ligand Of Eph-Related Kinase 3; Ephrin-A3; EHK1-L; Ehk1-L; Ephrin A3; LERK-3

  • AA Sequence

    QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.

  • Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His)
  • Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) Product Image