Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

Ephrin-A5, also referred to as EFNA5, is a member of the ephrin family of proteins that play pivotal roles in mediating cell-to-cell communication and tissue development. As a transmembrane protein, Ephrin-A5 functions as both a ligand and a receptor, engaging in bidirectional signaling interactions with Eph receptors on adjacent cells. This interaction initiates a cascade of intracellular events that modulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5 is particularly implicated in neuronal development, where it contributes to axon guidance and synaptic plasticity. Additionally, it plays a role in angiogenesis, influencing vascular development. The diverse functions of Ephrin-A5 underscore its significance in orchestrating complex cellular behaviors and highlight its involvement in various physiological and pathological processes. Gaining insights into the molecular mechanisms governed by Ephrin-A5 is crucial for understanding its potential implications in neurological disorders, developmental biology, and other medical contexts.

Immobilized Rhesus Macaque EFNA5 at 10 μg/mL (100 μL/well) can bind Mouse EPHA3. The ED₅₀ for this effect is 146.7 ng/mL.

• 
  Immobilized Rhesus Macaque EFNA5 at 10 μg/mLL (100 μL/well) can bind Mouse EPHA3. The ED₅₀ for this effect is 146.7 ng/mL.

Rhesus Macaque

HEK293

C-His

F7GZC7 (Q21-N203)

704351  [NCBI]

Partial

QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Approximately 27 kDa.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.