1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76322
Handling Instructions Technical Support

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5 (EFNA5) is a member of the ephrin family. Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

Background

Ephrin-A5, also referred to as EFNA5, is a member of the ephrin family of proteins that play pivotal roles in mediating cell-to-cell communication and tissue development. As a transmembrane protein, Ephrin-A5 functions as both a ligand and a receptor, engaging in bidirectional signaling interactions with Eph receptors on adjacent cells. This interaction initiates a cascade of intracellular events that modulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5 is particularly implicated in neuronal development, where it contributes to axon guidance and synaptic plasticity. Additionally, it plays a role in angiogenesis, influencing vascular development. The diverse functions of Ephrin-A5 underscore its significance in orchestrating complex cellular behaviors and highlight its involvement in various physiological and pathological processes. Gaining insights into the molecular mechanisms governed by Ephrin-A5 is crucial for understanding its potential implications in neurological disorders, developmental biology, and other medical contexts.

Biological Activity

Immobilized Rhesus Macaque EFNA5 at 10 μg/mL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL.

  • Immobilized Rhesus Macaque EFNA5 at 10 μg/mLL (100 μL/well) can bind Mouse EPHA3. The ED50 for this effect is 146.7 ng/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

F7GZC7 (Q21-N203)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-N203)
Accession # F7GZC7
His
C-term
Protein Length

Partial

Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

QDPGSKTVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Molecular Weight

Approximately 27 kDa.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76322
Quantity:
MCE Japan Authorized Agent: