1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin A5 Protein, Canine (HEK293, Fc)

Ephrin A5 Protein, Canine (HEK293, Fc)

Cat. No.: HY-P75755
COA Handling Instructions

Ephrin-A5/EFNA5 Protein is a member of the ephrin family of proteins, which are transmembrane proteins that act as both ligands and receptors. It interacts with Eph receptors on adjacent cells through bidirectional signaling, which triggers a series of intracellular events that regulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5/EFNA5 Protein plays a crucial role in the development of neurons, blood vessels, epithelia, embryonic development, and fertility. Ephrin A5 Protein, Canine (HEK293, Fc) is the recombinant canine-derived Ephrin A5 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin A5 Protein, Canine (HEK293, Fc) is 183 a.a., with molecular weight of ~59 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5/EFNA5 Protein is a member of the ephrin family of proteins, which are transmembrane proteins that act as both ligands and receptors. It interacts with Eph receptors on adjacent cells through bidirectional signaling, which triggers a series of intracellular events that regulate various cellular processes, including cell adhesion, repulsion, and migration. Ephrin-A5/EFNA5 Protein plays a crucial role in the development of neurons, blood vessels, epithelia, embryonic development, and fertility. Ephrin A5 Protein, Canine (HEK293, Fc) is the recombinant canine-derived Ephrin A5 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin A5 Protein, Canine (HEK293, Fc) is 183 a.a., with molecular weight of ~59 kDa.

Background

Ephrin-A5/EFNA5 Protein is a member of the ephrin family, which regulates cell shape and adhesion during development, cancer, and normal function in many different tissues, playing a crucial role in vascular and epithelial development. Ephrin-A5/EFNA5 Protein is a neuron cell guidance gene, associated with neuronal development, and contributes to axon guidance and synaptic plasticity. Ephrin-A5/EFNA5 Protein is necessary for optimal fertility and complete ovulatory response to gonadotropins, and is involved in regulating fertility[1].
Ephrin-A5/EFNA5 Protein is widely expressed in various cell types and organs during embryonic development, and regulates a wide range of early developmental processes, including tissue remodeling, bone and heart development, axon guidance, angiogenesis, and apoptosis. Ephrin-A5/EFNA5 Protein regulates apoptosis, proliferation, cell cycle progression, oocyte development, and steroidogenesis in ovarian granulosa cells (GC)[2].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human EphA3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Canine Ephrin A5. The ED50 for this effect is 10.19 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human EphA3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Canine Ephrin A5. The ED50 for this effect is 10.19 ng/mL.
Species

Canine

Source

HEK293

Tag

C-hFc

Accession

XP_850582 (Q21-N203)

Gene ID
Molecular Construction
N-term
Ephrin A5 (Q21-N203)
Accession # XP_850582
hFc
C-term
Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Molecular Weight

Approximately 59 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin A5 Protein, Canine (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin A5 Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P75755
Quantity:
MCE Japan Authorized Agent: