Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His)

Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Ephrin-B1/EFNB1, a cell surface transmembrane ligand for Eph receptors, plays a pivotal role in mediating contact-dependent bidirectional signaling during neuronal, vascular, and epithelial development. With high affinity for the receptor tyrosine kinase EPHB1/ELK, it also binds to EPHB2 and EPHB3. Binding to Eph receptors on neighboring cells initiates bidirectional signaling crucial for migration, repulsion, and adhesion. Additionally, EFNB1 is involved in inducing the collapse of commissural axons/growth cones in vitro and may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2 through its PDZ-binding motif and associates with TLE1. Moreover, the intracellular domain peptide of EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.

1. Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×10⁴ U/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized mouse EphB3 at 2 µg/mL (100 µL/well) can bind biotinylated mouse Ephrin-B1 Protein. The ED₅₀ for this effect is 9.785-10.16 ng/mL.

• 
  Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×10⁴ U/mg.

Mouse

HEK293

C-hFc;C-6*His

P52795 (K30-S229)

13641  [NCBI]

Partial

KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

58-80 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.