Erythropoietin receptor/EpoR Protein, Mouse (HEK293, His)

Erythropoietin receptor (EpoR) mediates erythropoietin-induced erythroblast proliferation and differentiation. After EPO stimulation, EpoR dimerizes, initiates the JAK2/STAT5 signaling cascade, and can activate STAT1, STAT3, and LYN tyrosine kinases in certain cell types. Erythropoietin receptor/EpoR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Erythropoietin receptor/EpoR protein, expressed by HEK293 , with C-His labeled tag.

Erythropoietin receptor (EpoR) serves as the key receptor for erythropoietin, orchestrating erythroblast proliferation and differentiation upon EPO stimulation. Through EpoR dimerization, it initiates the JAK2/STAT5 signaling cascade, leading to various cellular responses. In addition to activating STAT1 and STAT3 in specific cell types, EpoR may also engage the LYN tyrosine kinase. Upon EPO binding, EpoR forms homodimers and undergoes tyrosine phosphorylation, facilitating interactions with diverse SH2 domain-containing proteins such as LYN, APS, PTPN6, PTPN11, JAK2, PI3 kinases, STAT5A/B, SOCS3, CRKL, and ATXN2L. These interactions, intricate and multifaceted, modulate downstream signaling events, including mitogenic pathways and cell-surface expression. Notably, EpoR's interaction with NOSIP and the ubiquitin ligase NOSIP is implicated in EPO-induced cell proliferation, highlighting the regulatory complexity of EpoR-mediated signaling. Additionally, EpoR forms heterooligomers with FSFFV gp55 and associates with INPP5D/SHIP1, further expanding its functional repertoire in cellular processes.

Measured by its ability to inhibit Epo-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 17.15 ng/mL in the presence of 16 ng/mL of rmEpo, corresponding to a specific activity is 5.831×10⁴ units/mg.

• 
  Measured by its ability to inhibit Epo-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 17.15 ng/mL in the presence of 16 ng/mL of rmEpo, corresponding to a specific activity is 5.831×10⁴ units/mg.

Mouse

HEK293

C-His

P14753 (A25-P249)

13857  [NCBI]

Extracellular Domain

APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

28-35 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.