1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. Exodus-2/CCL21 Protein, Mouse

Exodus-2/CCL21 Protein, Mouse

Cat. No.: HY-P7167
Handling Instructions

Exodus-2/CCL21 Protein, Mouse signals through the chemokine receptor CCR7 and CXCR3, and promotes fibrosis, inflammatory cytokine production.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Exodus-2/CCL21 Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products

Exodus-2/CCL21 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P86792 (S24-G133)

Gene ID

65956

Synonyms
rMuExodus-2/CCL21; C-C motif chemokine 21; SLC; SCYA21
AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Weight

Approximately 12.1 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using murine T-lymphocytes is in a concentration range of 10-100 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CCL21, also known as 6Ckine, TCA4, SLC, Exodus2, and A21, is a 12 kDa homeostatic chemokine that plays an important role in adaptive immune responses and inflammation[1]. Mature mouse CCL21 shares 71% and 84% aa sequence identity with human and rat CCL21, respectively[2]. Expression of the lymphoid chemokine CCL21/SLC is found to be induced in almost all venules surrounded by inflammatory cuffs in brain and spinal cord sections of mice afflicted with active EAE[3].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Exodus-2/CCL21 Protein, Mouse
Cat. No.:
HY-P7167
Quantity:
MCE Japan Authorized Agent: