FGF-1 Protein, Mouse
Based on 1 publication(s) in Google Scholar
FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.
- Species: Mouse
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Références
- Help & FAQs
Activité biologique
FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.
Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific[1].
1.The ED50 is <2 ng/mL as measured by Balb3T3 cells, corresponding to a specific activity of >5 × 105 units/mg.
2.Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is ≤1.2 ng/mL in the presence of 10 µg/mL of heparin.
-
Measured in a cell proliferation assay using NIH3T3 cells. The ED50 for this effect is 1.186 ng/mL in the presence of 10 µg/mL heparin, corresponding to a specific activity is 8.431×105 units/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int J Biol Macromol
FGF1 alleviates polystyrene nanoplastics-induced neuroinflammation through the suppression of lipophagy. [Abstract]2025 Jan 30:302:140531. PMID: 39892539
FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jan 30:302:140531. [Abstract]
SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Representative IF image showed the autophagosome distributions. Cells were treated with fluorescent PS-NPs, and the autophagosomes were stained with an MDC probe. The results showed that FGF1 treatment decreased the autophagic flux in PS-NPs-exposed SH-SY5Y cells.
FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jan 30:302:140531. [Abstract]
SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Protein levels of lipophagy-related proteins were tested. The results demonstrated FGF1 reversed PS-NPs-induced abnormal expression of multiple proteins in SH-SY5Y cells, downregulating protein levels of Rab7, Lamp2 and LC3 and upregulating those of Plin2 and p62.
FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jan 30:302:140531. [Abstract]
C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. In vitro imaging showed the PS-NPs accumulation in the brains of mice, n = 5. The results showed that FGF1 treatment mitigated the accumulation of PS-NPs in mouse brain.
FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jan 30:302:140531. [Abstract]
C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Myelin sheath in the mouse hippocampus stained by the LFB assay, n = 3.
FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jan 30:302:140531. [Abstract]
C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Representative MRI scanning image of the mouse hippocampus, n = 3. MRI scanning revealed that PS-NPs exposure decreased hippocampal volume in the right brain of the mice, and these changes were alleviated under the co-treatment with exogenous FGF1.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P61148 (F16-D155)
-
Molecular Construction
-
N-term
-
FGF-1 (F16-D155)
Accession # P61148 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rMuaFGF; HBGF-1; FGF1; FGF-a; FGF-acidic
-
AA Sequence
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
-
Predicted Molecular Mass
15.8 kDa
-
Masse moléculaire
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Instruction de manipulation (2659 KB)
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
