Copy Link Print Information

FGF-1 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • FGF-1 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

Background

Acidic Fibroblast Growth Factor is involved in a wide spectrum of biological functions including tissue development and repair, angiogenesis, proliferation of both epithelial and mesenchymal cells, and tumorigenesis. The biological activities of Acidic Fibroblast Growth Factor depend on binding to highly specific cell surface receptors, among which, fibroblast growth factor receptor 4 (FGFR4) is highly specific[1].

Verified Bioactivity

1.The ED50 is <2 ng/mL as measured by Balb3T3 cells, corresponding to a specific activity of >5 × 105 units/mg.
2.Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is ≤1.2 ng/mL in the presence of 10 µg/mL of heparin.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P61148 (F16-D155)

  • Gene ID
    14164  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-1 (F16-D155)
      Accession # P61148
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli

  • AA Sequence

    FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

  • Predicted Molecular Mass

    15.8 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54(1):37-41. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH3T3 cells. The ED50 for this effect is 1.186 ng/mL in the presence of 10 µg/mL heparin, corresponding to a specific activity is 8.431×105 units/mg.

  • 1/16

    FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    Customer Validation
     SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Representative IF image showed the autophagosome distributions. Cells were treated with fluorescent PS-NPs, and the autophagosomes were stained with an MDC probe. The results showed that FGF1 treatment decreased the autophagic flux in PS-NPs-exposed SH-SY5Y cells.

  • 1/16

    FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    Customer Validation
     SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Protein levels of lipophagy-related proteins were tested. The results demonstrated FGF1 reversed PS-NPs-induced abnormal expression of multiple proteins in SH-SY5Y cells, downregulating protein levels of Rab7, Lamp2 and LC3 and upregulating those of Plin2 and p62.

  • 1/16

    FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    Customer Validation
     C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. In vitro imaging showed the PS-NPs accumulation in the brains of mice, n = 5. The results showed that FGF1 treatment mitigated the accumulation of PS-NPs in mouse brain.

  • 1/16

    FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    Customer Validation
     C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Myelin sheath in the mouse hippocampus stained by the LFB assay, n = 3.

  • 1/16

    FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    Customer Validation
     C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Representative MRI scanning image of the mouse hippocampus, n = 3. MRI scanning revealed that PS-NPs exposure decreased hippocampal volume in the right brain of the mice, and these changes were alleviated under the co-treatment with exogenous FGF1.

  • FGF-1 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • Experimental Validation Results for FGF-1 Protein, Mouse
  • FGF-1 Protein, Mouse Product Image

  • FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Representative IF image showed the autophagosome distributions. Cells were treated with fluorescent PS-NPs, and the autophagosomes were stained with an MDC probe. The results showed that FGF1 treatment decreased the autophagic flux in PS-NPs-exposed SH-SY5Y cells.

  • FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    SH-SY5Y cells were exposed to PS-NPs (100 μg/mL, 24 h) alone or cotreated with FGF-1 Protein, Mouse (FGF1, 100 ng/mL, 24 h). Protein levels of lipophagy-related proteins were tested. The results demonstrated FGF1 reversed PS-NPs-induced abnormal expression of multiple proteins in SH-SY5Y cells, downregulating protein levels of Rab7, Lamp2 and LC3 and upregulating those of Plin2 and p62.

  • FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. In vitro imaging showed the PS-NPs accumulation in the brains of mice, n = 5. The results showed that FGF1 treatment mitigated the accumulation of PS-NPs in mouse brain.

  • FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Myelin sheath in the mouse hippocampus stained by the LFB assay, n = 3.

  • FGF-1 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Apr:302:140531. [Abstract]

    C57BL/6 mice were exposed to fluorescent PS-NPs (50 mg/kg, 30 d) with or without co-treatment of FGF-1 Protein, Mouse (FGF1, 0.5 mg/kg; s.c.; once every two days for 30 d), n = 6 for each group. Representative MRI scanning image of the mouse hippocampus, n = 3. MRI scanning revealed that PS-NPs exposure decreased hippocampal volume in the right brain of the mice, and these changes were alleviated under the co-treatment with exogenous FGF1.