1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-1
  6. FGF-1 Protein, Cynomolgus

Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 is a ligand of FGFR1 and integrin, and plays an important role in cell survival, division, angiogenesis, differentiation, and migration. FGF-1 induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and also stimulates angiogenesis. FGF-1 Protein, Cynomolgus is the recombinant cynomolgus-derived FGF-1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 is a ligand of FGFR1 and integrin, and plays an important role in cell survival, division, angiogenesis, differentiation, and migration. FGF-1 induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and also stimulates angiogenesis. FGF-1 Protein, Cynomolgus is the recombinant cynomolgus-derived FGF-1 protein, expressed by E. coli , with tag free.

Background

Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 protein plays a critical role in the regulation of a variety of cellular processes, including cell survival, division, angiogenesis, differentiation, and migration. It acts as a potent mitogen and as a ligand for FGFR1 and integrin. In the presence of heparin, FGF-1 binds to FGFR1, leading to dimerization and activation through autophosphorylation of tyrosine residues. FGF-1 also binds to the integrin ITGAV: ITGB3, forms a ternary complex with FGFR1 and induces PTPN11 recruitment to the complex. It induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and can also stimulate angiogenesis. FGF-1 interacts with a variety of receptors and proteins, including FGFR2, FGFR3, FGFR4, FGFBP1, S100A13, SYT1, LRRC59, CSNKA, CSNKB and FIBP[1][2][3].

Species

Cynomolgus

Source

E. coli

Tag

Tag Free

Accession

NP_001252958.1 (F16-D155)

Gene ID
Molecular Construction
N-term
FGF-1 (F16-D155)
Accession # NP_001252958.1
C-term
Protein Length

Partial

Synonyms
HBGF-1; ECGF; FGF1; FGF-a; FGF-acidic
AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Predicted Molecular Mass
16 kDa
Molecular Weight

Approximately 16 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-1 Protein, Cynomolgus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-1 Protein, Cynomolgus

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-1 Protein, Cynomolgus
Cat. No.:
HY-P76332
Quantity:
MCE Japan Authorized Agent: