FGF-1 Protein, Cynomolgus
Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 is a ligand of FGFR1 and integrin, and plays an important role in cell survival, division, angiogenesis, differentiation, and migration. FGF-1 induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and also stimulates angiogenesis. FGF-1 Protein, Cynomolgus is the recombinant cynomolgus-derived FGF-1 protein, expressed by E. coli , with tag free.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 is a ligand of FGFR1 and integrin, and plays an important role in cell survival, division, angiogenesis, differentiation, and migration. FGF-1 induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and also stimulates angiogenesis. FGF-1 Protein, Cynomolgus is the recombinant cynomolgus-derived FGF-1 protein, expressed by E. coli , with tag free.
Fibroblast growth factor 1 is a growth factor and signaling protein encoded by the FGF1 gene. FGF-1 protein plays a critical role in the regulation of a variety of cellular processes, including cell survival, division, angiogenesis, differentiation, and migration. It acts as a potent mitogen and as a ligand for FGFR1 and integrin. In the presence of heparin, FGF-1 binds to FGFR1, leading to dimerization and activation through autophosphorylation of tyrosine residues. FGF-1 also binds to the integrin ITGAV: ITGB3, forms a ternary complex with FGFR1 and induces PTPN11 recruitment to the complex. It induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2, and AKT1, and can also stimulate angiogenesis. FGF-1 interacts with a variety of receptors and proteins, including FGFR2, FGFR3, FGFR4, FGFBP1, S100A13, SYT1, LRRC59, CSNKA, CSNKB and FIBP[1][2][3].
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag Tag Free
-
Accession
NP_001252958.1 (F16-D155)
-
Molecular Construction
-
N-term
-
FGF-1 (F16-D155)
Accession # NP_001252958.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli
-
AA Sequence
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
-
Predicted Molecular Mass
16 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
