FLT3LG Protein, Mouse (HEK293, Fc)

FLT3LG Proteinas, a potent stimulator, activates FLT3, synergizing with colony-stimulating factors and interleukins. Its homodimeric form, especially in the soluble isoform, effectively promotes the expansion and differentiation of hematopoietic progenitor cells. The protein's significance lies in orchestrating key processes within the hematopoietic system. FLT3LG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FLT3LG protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FLT3LG Protein, Mouse (HEK293, Fc) is 162 a.a., with molecular weight of ~35 & 55-65 kDa, respectively.

The FLT3LG protein acts as a potent stimulator, fostering the proliferation of early hematopoietic cells through the activation of FLT3. Exhibiting synergistic effects, particularly in its soluble isoform, this homodimeric protein collaborates effectively with various colony-stimulating factors and interleukins. Its role in promoting the expansion and differentiation of hematopoietic progenitor cells underscores its significance in orchestrating key processes within the hematopoietic system.

1.Measured in a cell proliferation assay using BaF3 mouse pro­B cells transfected with mouse Flt­3 and the ED₅₀ is typically 1-30 ng/mL.
2.Mouse FLT3 Ligand, hFc Tag captured on CM5 Chip via Protein A can bind Human FLT3, His Tag with an affinity constant of 13.81 nM as determined in SPR assay (Biacore T200).

Mouse

HEK293

C-hFc

P49772-1 (G27-R188)

14256  [NCBI]

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR

Approximately 35&55-65 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.