1. Recombinant Proteins
  2. FLT3LG Protein, Mouse (CHO, His)

FLT3LG Protein, Mouse (CHO, His)

Cat. No.: HY-P7354
Handling Instructions

FLT3LG Protein, Mouse (CHO, His) is a ligand of mouse Flt-3, induces proliferation of haematopoietic progenitor cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuFlt-3 Ligand, His; Fms-related tyrosine kinase 3 ligand; SL cytokine; Flt3lg
Species

Mouse

Source

CHO

Accession

P49772 (G27-R188)

Gene ID

14256

Molecular Weight

24-30 kDa

AA Sequence

GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH

Biological Activity
The ED50 is <10 ng/mL as measured by AML5 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Flt-3 ligand induces proliferation of highly purified haematopoietic progenitor cells in synergy with a number of other growth factors including IL-11, IL-12, granulocyte colony-stimulating factor (G-CSF), and IL-3[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FLT3LG Protein, Mouse (CHO, His)
Cat. No.:
HY-P7354
Quantity:
MCE Japan Authorized Agent: