FLT3LG Protein, Rat (sf9, His)

The FLT3LG protein has the same protein-binding and receptor tyrosine kinase-binding activities predicted to positively regulate natural killer cell proliferation. Intended to be located on the cell surface and extracellular space, it serves as an intrinsic component on the outside of the plasma membrane. FLT3LG Protein, Rat (sf9, His) is the recombinant rat-derived FLT3LG protein, expressed by Sf9 insect cells , with C-His labeled tag.

The FLT3LG protein is predicted to possess identical protein binding activity and receptor tyrosine kinase binding activity. It plays a role in the positive regulation of natural killer cell proliferation and is anticipated to be located in the cell surface and extracellular space, serving as an intrinsic component of the external side of the plasma membrane. This protein has been utilized in the study of pancreatic cancer. In the context of human diseases, orthologs of this gene are implicated in colon carcinoma, glioblastoma, and high-grade glioma. The FLT3LG gene is orthologous to the human FLT3LG gene (fms related receptor tyrosine kinase 3 ligand). [provided by Alliance of Genome Resources, Apr 2022]

Rat

Sf9 insect cells

C-10*His

NP_001292868 (T28-Q189)

103691134  [NCBI]

Partial

TPDCYFSHSPISSNFHMRISELTDYLLKDYPVTVAINLQDEKHCKALWSLFLAHRWIEQLKTVAGSKMQKLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLQDTCSQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPESPGALGATELPKPLPRQ

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/bb49-hnc-cell.html