FLT3LG Protein, Rat (sf9, His)
The FLT3LG protein has the same protein-binding and receptor tyrosine kinase-binding activities predicted to positively regulate natural killer cell proliferation. Intended to be located on the cell surface and extracellular space, it serves as an intrinsic component on the outside of the plasma membrane. FLT3LG Protein, Rat (sf9, His) is the recombinant rat-derived FLT3LG protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FLT3LG protein has the same protein-binding and receptor tyrosine kinase-binding activities predicted to positively regulate natural killer cell proliferation. Intended to be located on the cell surface and extracellular space, it serves as an intrinsic component on the outside of the plasma membrane. FLT3LG Protein, Rat (sf9, His) is the recombinant rat-derived FLT3LG protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The FLT3LG protein is predicted to possess identical protein binding activity and receptor tyrosine kinase binding activity. It plays a role in the positive regulation of natural killer cell proliferation and is anticipated to be located in the cell surface and extracellular space, serving as an intrinsic component of the external side of the plasma membrane. This protein has been utilized in the study of pancreatic cancer. In the context of human diseases, orthologs of this gene are implicated in colon carcinoma, glioblastoma, and high-grade glioma. The FLT3LG gene is orthologous to the human FLT3LG gene (fms related receptor tyrosine kinase 3 ligand). [provided by Alliance of Genome Resources, Apr 2022]
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-10*His
-
Accession
NP_001292868 (T28-Q189)
-
Molecular Construction
-
N-term
-
FLT3LG (T28-Q189)
Accession # NP_001292868 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FLT3LG; IMD125; Fms Related Receptor Tyrosine Kinase 3 Ligand; FLG3L; Fms-Related Tyrosine Kinase 3 Ligand; FLT3L; Fms Related Tyrosine Kinase 3 Ligand; Flt3L; Flt3 Ligand; FL; SL Cytokine
-
AA Sequence
TPDCYFSHSPISSNFHMRISELTDYLLKDYPVTVAINLQDEKHCKALWSLFLAHRWIEQLKTVAGSKMQKLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLQDTCSQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPESPGALGATELPKPLPRQ
-
Predicted Molecular Mass
19.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
